PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG029931t1
Common NameTCM_029931
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 352aa    MW: 38911.6 Da    PI: 9.5885
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG029931t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.33.6e-54151421128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeelvv+yLk+k+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+++
  Thecc1EG029931t1  15 LPPGFRFHPTDEELVVHYLKRKAASAPLPV-TIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPIV 106
                       79****************************.89***************8888999*************************************9 PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++ ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  Thecc1EG029931t1 107 TSnGNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 142
                       9867788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-658176IPR003441NAC domain
PROSITE profilePS5100562.44715176IPR003441NAC domain
PfamPF023652.4E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MESTDSSSAS PHPQLPPGFR FHPTDEELVV HYLKRKAASA PLPVTIIAEV DLYKFDPWEL  60
PSKATFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPIVTSNG NQKVGVKKAL  120
VFYGGKPPKG IKTNWIMHEY RLVDNNSTSK PQIADVANRK GSLRLDDWVL CRIYKKNNTQ  180
RPMERDKDYS TVGMLATLPT STHQNPKPPT SKATSYGSLL ENEENFFEGI LTGEGMQHST  240
ISQIPAASSS SKQDLSMSLA STTTNTFPVK RTIPPQYWNE PNSSFGSQSG KRFQGDLNSS  300
STAGIDDTNS FVSLLHHLPQ NAPFYPGTLV GSLGDGVSRQ QFILPSMNWN S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-771517917168NO APICAL MERISTEM PROTEIN
1ut4_B7e-771517917168NO APICAL MERISTEM PROTEIN
1ut7_A7e-771517917168NO APICAL MERISTEM PROTEIN
1ut7_B7e-771517917168NO APICAL MERISTEM PROTEIN
4dul_A7e-771517917168NAC domain-containing protein 19
4dul_B7e-771517917168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025712.10.0PREDICTED: NAC transcription factor 25
SwissprotQ9LD441e-109NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A061GMK30.0A0A061GMK3_THECC; NAC domain containing protein 25
STRINGEOY283340.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-110NAC domain containing protein 25
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]