PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG029832t1
Common NameTCM_029832
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family SBP
Protein Properties Length: 142aa    MW: 16029.7 Da    PI: 8.139
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG029832t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP137.63.6e-4356132278
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       Cqve+C++d+++ak+yhrrhkvCe+h+kapvv vsgl+qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk+++
  Thecc1EG029832t1  56 CQVENCTTDMNDAKRYHRRHKVCEFHAKAPVVRVSGLQQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSSS 132
                       **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375755.8E-631141IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.101.1E-3548117IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.84753130IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-4054134IPR004333Transcription factor, SBP-box
PfamPF031102.2E-3356129IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MATSRAEGKR SLKEMAEDEE EEEDEDAGAL GFVDEEKKKK GKRGSSTGGG SALPSCQVEN  60
CTTDMNDAKR YHRRHKVCEF HAKAPVVRVS GLQQRFCQQC SRFHELSEFD EAKRSCRRRL  120
AGHNERRRKS SSEYHGEGSN Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-4047129284squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025578.11e-100Squamosa promoter binding protein-like 3
SwissprotQ387413e-54SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A061GEC81e-100A0A061GEC8_THECC; Squamosa promoter-binding-like protein
STRINGPOPTR_0001s40870.12e-52(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-45squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]