PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG029796t1
Common NameTCM_029796
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 321aa    MW: 36046.8 Da    PI: 8.4157
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG029796t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.24e-50161441128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+ +yLk+k++ ++++   +i++v+iyk++Pw+Lp k+  +e+ew+fFs+rdkky++g+r+nra++sgyWkatg+dk+++
  Thecc1EG029796t1  16 LPPGFRFHPTDEELIIHYLKQKASPSSNPPILIIADVNIYKFNPWELPDKAFFGENEWFFFSPRDKKYPNGTRPNRAAASGYWKATGTDKPII 108
                       79**********************999777678***************7777899************************************** PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s+ +++  g+kk Lvfykg+ pkg+ktdW+m ey l
  Thecc1EG029796t1 109 SSvGSQCLGMKKALVFYKGHPPKGVKTDWMMTEYML 144
                       9978888***************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-6110171IPR003441NAC domain
PROSITE profilePS5100557.1916171IPR003441NAC domain
PfamPF023652.8E-2517143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MFSTLQKQIA RPSASLPPGF RFHPTDEELI IHYLKQKASP SSNPPILIIA DVNIYKFNPW  60
ELPDKAFFGE NEWFFFSPRD KKYPNGTRPN RAAASGYWKA TGTDKPIISS VGSQCLGMKK  120
ALVFYKGHPP KGVKTDWMMT EYMLLDDYFS SQRPKGSMRL DDWVLCRVRQ KSKVPQQLGG  180
RNYSGSSCSP PFSRGYLQGQ EMTIENANIL HGHHQLPAQY QMSPLESEEL DEKGQIMDLQ  240
EGSPEYSLSN SPKTIDSNVR NVLKSIEREL SVGALDELLP SQPDKRLKVS ASDNSPANAS  300
VFQISFPAPS ASYQQHFSEF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-641517716171NO APICAL MERISTEM PROTEIN
1ut4_B1e-641517716171NO APICAL MERISTEM PROTEIN
1ut7_A1e-641517716171NO APICAL MERISTEM PROTEIN
1ut7_B1e-641517716171NO APICAL MERISTEM PROTEIN
3swm_A2e-641517719174NAC domain-containing protein 19
3swm_B2e-641517719174NAC domain-containing protein 19
3swm_C2e-641517719174NAC domain-containing protein 19
3swm_D2e-641517719174NAC domain-containing protein 19
3swp_A2e-641517719174NAC domain-containing protein 19
3swp_B2e-641517719174NAC domain-containing protein 19
3swp_C2e-641517719174NAC domain-containing protein 19
3swp_D2e-641517719174NAC domain-containing protein 19
4dul_A1e-641517716171NAC domain-containing protein 19
4dul_B1e-641517716171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017978342.10.0PREDICTED: NAC transcription factor 56
SwissprotK4BWV21e-72NAP1_SOLLC; NAC domain-containing protein 1
TrEMBLA0A061GFH90.0A0A061GFH9_THECC; NAC domain containing protein 25
STRINGEOY281480.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1928557
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.13e-74NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]