PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG029774t1
Common NameTCM_029774
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 258aa    MW: 28763.3 Da    PI: 8.0226
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG029774t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.43.7e-3615110196
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       aCaaCk++rrkC +dCv+ap+fpa++++ f+ vhk+FG++nv++ll++l++++r++a++sl +eA a+ +dPv G +g+++kl+++le lk++
  Thecc1EG029774t1  15 ACAACKHQRRKCDNDCVFAPHFPANRAHYFREVHKIFGVKNVTNLLEHLDDNDRRRAVESLQWEAFAWKEDPVLGPLGLFKKLEKELELLKEQ 107
                       7*******************************************************************************************9 PP

            DUF260  94 lal 96 
                       l+ 
  Thecc1EG029774t1 108 LNN 110
                       985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.72614115IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-3415109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MSSGNGEEVL NSRHACAACK HQRRKCDNDC VFAPHFPANR AHYFREVHKI FGVKNVTNLL  60
EHLDDNDRRR AVESLQWEAF AWKEDPVLGP LGLFKKLEKE LELLKEQLNN PQPVVPYQTK  120
SGLIGFNHNS AGFVANGDDI SIANFGYANS PNLGLDVNMN NYAGFFQRAD NMENQGVNNI  180
PVVPYYPIPE GQGRLVMQER VLDPVVRTTP VLPKQDAQSN QIIGSSMRPA SHQRGSQGRA  240
HAYYDGSVSG PQARRMH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025493.10.0LOB domain-containing-like protein
TrEMBLA0A061GE100.0A0A061GE10_THECC; LOB domain-containing-like protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1960367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.13e-26LOB domain-containing protein 2
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]