PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG029628t1
Common NameTCM_029628
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family BES1
Protein Properties Length: 328aa    MW: 35159.9 Da    PI: 8.651
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG029628t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822217.72.7e-6721461149
            DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspess 93 
                       ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp ++++++g sasasp+ss
  Thecc1EG029628t1   2 TSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEEDGTTYRKGCKPVDRMDIVGGSASASPCSS 94 
                       5899***************************************************************************************** PP

            DUF822  94 lqsslkssalaspvesysaspksssfpspssldsislasa....asllpvlsvlslvsss 149
                       ++        +sp++sy++sp+sssfpsp+s+  +s+a+     +sl+p+l++l+++sss
  Thecc1EG029628t1  95 YH--------PSPCASYNPSPASSSFPSPASSHYTSNANGngdaNSLIPWLKNLTSSSSS 146
                       **........********************999998877688999********9887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.9E-683140IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MTSGTRMPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCNEAG  60
WTVEEDGTTY RKGCKPVDRM DIVGGSASAS PCSSYHPSPC ASYNPSPASS SFPSPASSHY  120
TSNANGNGDA NSLIPWLKNL TSSSSSASSK LAHHLYIAGG SISAPVTPPL SSPTSRTPRT  180
RNEWDERTAA SAWAGQRYSY LPSSTPPSPS RQGFPDSGWL SRLEIPQSGP TSPTFSLVSR  240
NPFGFKDETL SGGGSRMWTP GQSGTCSPAF PAGVDQTSDV PMSDAIAAEF AFGSNVTGLV  300
KPWEGEKIHE ECVADDLELT LGNSKTR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025289.10.0BES1/BZR1
SwissprotQ9ZV881e-140BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A061GE960.0A0A061GE96_THECC; BES1/BZR1
STRINGPOPTR_0004s06100.11e-163(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-106BES1/BZR1 homolog 4
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]