PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG029543t1
Common NameTCM_029543
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 372aa    MW: 41594.4 Da    PI: 9.6328
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG029543t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.43.4e-34163220259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp+vv++tYeg+Hnh+
  Thecc1EG029543t1 163 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCTVKKRVERSFQDPSVVITTYEGQHNHP 220
                       8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-35147222IPR003657WRKY domain
SuperFamilySSF1182907.98E-30154222IPR003657WRKY domain
PROSITE profilePS5081132.65157222IPR003657WRKY domain
SMARTSM007742.8E-40162221IPR003657WRKY domain
PfamPF031061.6E-26163220IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MSDHEFRDFY YQAAFHNDQQ GVGETGMYRV SSSLQDPSYM SFTDCLHSSM DYGSLEKAFG  60
LSPSSSEVFS SVEGNQTKQV GAGDLGGNTS EVMTTPNSSV SSSSSEAGCE EDSDKSKKDR  120
QPKGSEDGGE SSKKGNKAKK KGEKKQREPR FAFMTKSEVD HLEDGYRWRK YGQKAVKNSP  180
YPRSYYRCTT QKCTVKKRVE RSFQDPSVVI TTYEGQHNHP LPTTLRGSAA GLFPPSMLTP  240
SPLAGPSFPH ELFMQMPHHM NNQAGSAGSM FAESFSPFQQ YHHQVPDYGL LQDIVPSRLF  300
TDFVQRVALK TNFKEIHVRI LTPKTESKIA TRKPNPTTAP RQQQPWRERK NKGRAKTTSY  360
RTLFSILQAS C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-29152222777Probable WRKY transcription factor 4
2lex_A3e-29152222777Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00440DAPTransfer from AT4G18170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017978107.10.0PREDICTED: probable WRKY transcription factor 71
SwissprotQ8VWJ22e-74WRK28_ARATH; WRKY transcription factor 28
TrEMBLA0A061GF560.0A0A061GF56_THECC; WRKY DNA-binding protein 28
STRINGEOY277870.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15242693
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.15e-61WRKY DNA-binding protein 28
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Kim SH, et al.
    Characterization of a Novel DWD protein that participates in heat stress response in Arabidopsis.
    Mol. Cells, 2014. 37(11): p. 833-40
    [PMID:25358503]
  5. Zhao L, et al.
    KLU suppresses megasporocyte cell fate through SWR1-mediated activation of WRKY28 expression in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(3): p. E526-E535
    [PMID:29288215]