PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG029315t1
Common NameTCM_029315
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 172aa    MW: 18452 Da    PI: 8.3863
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG029315t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.95.6e-46131121100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++
  Thecc1EG029315t1  13 PCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQELPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDALQTQ 105
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       lal+++e
  Thecc1EG029315t1 106 LALAQAE 112
                       **99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.51112113IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MKESGRKQGA ASPCAACKLL RRRCAQDCVF APYFPADEPQ KFANVHKVFG ASNVNKMLQE  60
LPVHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID ALQTQLALAQ AEVVHLRVRQ  120
TASFSHHGFG PASPSNSGSP SSKLMGSQAK PMFDVDMVVD HASLGESMWS C*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007024850.11e-125LOB domain-containing protein 4 isoform 1
SwissprotQ9SHE99e-86LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A061GE841e-125A0A061GE84_THECC; LOB domain-containing protein 4 isoform 1
STRINGPOPTR_0001s11610.11e-104(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.17e-78LOB domain-containing protein 4
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]