PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG029052t1
Common NameTCM_029052
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 229aa    MW: 26129.3 Da    PI: 6.8404
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG029052t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.63.2e-41141131100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn++k++k+l + e+++am+++v++++ara+dPv G++++i++lq+q+e ++ae
  Thecc1EG029052t1  14 ACAACKYQRRKCAPDCILAPYFPHDRQRQFLNAHKLFGVSNITKIIKNLTPPEKDIAMRTIVFQSDARANDPVGGCYRIIQELQRQIEYSQAE 106
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       l+l+ ++
  Thecc1EG029052t1 107 LDLVFHQ 113
                       *998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.47313114IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-3814109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MSIPRTGSNG TTQACAACKY QRRKCAPDCI LAPYFPHDRQ RQFLNAHKLF GVSNITKIIK  60
NLTPPEKDIA MRTIVFQSDA RANDPVGGCY RIIQELQRQI EYSQAELDLV FHQLAICRAQ  120
AHQQQQQSHL QMHEPGDSSL GCEMVNADPL NSYNSNYYYV EEPHEQQFSV NNNHHHLQEN  180
YDSWGIQEST TLDSLNVKQS FIRVSDNEVK PDLDILVKDI RSGLRLKN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2164676e-50AC216467.1 Populus trichocarpa clone POP034-D10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007024503.11e-173LOB domain-containing protein 22
SwissprotQ9LRW12e-72LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A061GB711e-173A0A061GB71_THECC; LOB domain-containing protein 22
STRINGAT3G13850.15e-70(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-64LOB domain-containing protein 22
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]