PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG028771t1
Common NameTCM_028771
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family CPP
Protein Properties Length: 576aa    MW: 63389.3 Da    PI: 8.1871
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG028771t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR38.91.7e-12125162442
               TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                       k+C Ck+skClk+YCeCfa++++C+  C+C dC+N+ e+
  Thecc1EG028771t1 125 KQCGCKQSKCLKLYCECFASREYCNG-CNCADCCNNVEN 162
                       89************************.********9875 PP

2TCR521.4e-16208245239
               TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                       +++gC+Ckks+Clk+YCeCf+a+++Cse+CkC dCkN 
  Thecc1EG028771t1 208 HERGCHCKKSECLKRYCECFQANVFCSENCKCMDCKNF 245
                       889**********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.7E-10122162IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163433.806123247IPR005172CRC domain
PfamPF036385.1E-9125159IPR005172CRC domain
SMARTSM011143.0E-17207248IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.8E-13210245IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MRQLEIENGD FPPKTIEVVT ATPCFPPKGI KSVERTRDSV KVTVKERSSP HFPPKKKLAR  60
QLIFTEFGLS PIITTSPPLP VVKPSSELHL SPRCAFSSIK SETPIPIPLP QANIKANSGT  120
PKGPKQCGCK QSKCLKLYCE CFASREYCNG CNCADCCNNV ENGDLRKAAA EIILERNPHA  180
FKPKIASTPC SPQNVGGDKE DTPPVGRHER GCHCKKSECL KRYCECFQAN VFCSENCKCM  240
DCKNFEVCKG TMAASGKDDS KSKICENSKG CEGRIAISPK DNGNRKFYRS FKGSEGLMAE  300
IGEDCIDTKI YTQRVTAATS NATGLSGQCL SQESRKRKHL ELHSNEKETL IESFSDFQKV  360
NNLKNSCPSA TLSVEPTCHI INSAMVGSFR HPYRLTLADV LHLEDTRKVC SGLAVLAEAA  420
KQFADKVGKA DVKDAAENKH GDALGAKEKD CQGGPAYFQK RVPDDLHLDG GATDAHEGRT  480
LPHGTVKLIC NEKHKQFMEP TSPKQILDRD IKNASAEQER CVLSSFRDFL EKLITFTNIK  540
DEAFLFPYWY LVHVTGTNEF SSARAVLMEK TGTEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-2112524612122Protein lin-54 homolog
5fd3_B1e-2112524612122Protein lin-54 homolog
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017978183.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
TrEMBLA0A061GAC50.0A0A061GAC5_THECC; Tesmin/TSO1-like CXC domain-containing protein
STRINGEOY268150.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2219645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.12e-65Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]