PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG028353t2
Common NameTCM_028353
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family CPP
Protein Properties Length: 587aa    MW: 65404.4 Da    PI: 4.8979
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG028353t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.73e-15277315341
               TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                        k+CnC+ s+Clk+YCeCfaag +C ++C Ce+C N+++
  Thecc1EG028353t2 277 FKRCNCQMSRCLKLYCECFAAGLYCVDSCACENCYNRTD 315
                       699*********************************875 PP

2TCR47.24.4e-15362401140
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       ++k+gC+Ck+skClkkYCeC+ a++ Cs  C+Ce+C N+ 
  Thecc1EG028353t2 362 RHKRGCKCKRSKCLKKYCECYRAKVGCSGGCRCEGCDNSF 401
                       589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.4E-12275316IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163432.371276402IPR005172CRC domain
PfamPF036383.0E-11278313IPR005172CRC domain
SMARTSM011145.9E-14362403IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.3E-11364400IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MEMPLRRSLL PHYEEIAAST SNAHGQLYSP SSSALIPCIQ KQFQSCNPSE CVDDFLADPL  60
EVDSAQHAET FLQSANVVPL LLPSCFTASQ VTTKNDDYTN DWVVEVGAQT LPHLSKKHLL  120
SGSLILLEGS GDQSIDESFD KILKFSSENI CNYVEPDELL EHQEASQHQR GIRRHLRFEA  180
TLDCKDNAAF NCHTSSRVRE VVDHVDSDHQ SSEAVVVDNE GHLPDNIEPP WDTQQVSCFD  240
QQTLPCGGQR VEVLSQYAES SKGKRNRETY TYESGDFKRC NCQMSRCLKL YCECFAAGLY  300
CVDSCACENC YNRTDYEDWV EDSREQIELR NPLAFAPTIV EQANDSPILA DDGNWTTPSS  360
ARHKRGCKCK RSKCLKKYCE CYRAKVGCSG GCRCEGCDNS FGKKSESIFQ REEEWKNLLN  420
MEELMSDQKG GTANQFSPTW EELGNTSHLT PLSHQVPSLI LSKIWDFPYI SQAQPQDGSG  480
LQLSPGQLHW YSSALASVNA PCEIMGDGSP HIHNDNSNPA NKLQSGSPNQ ERVFPPQQIQ  540
SDRLGSSSTA GLQSGRKLSS QAVSSFPPLS PHRNSKDRMN QIEDEQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A8e-1627842112133Protein lin-54 homolog
5fd3_B8e-1627842112133Protein lin-54 homolog
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007023934.20.0PREDICTED: protein tesmin/TSO1-like CXC 2
TrEMBLA0A061GAF80.0A0A061GAF8_THECC; Tesmin/TSO1-like CXC domain-containing protein isoform 2
STRINGEOY265550.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.14e-56Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]