PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG027945t1
Common NameTCM_027945
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 399aa    MW: 45370.5 Da    PI: 7.0018
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG027945t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.14.1e-50391642128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                       +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + +
  Thecc1EG027945t1  39 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRA 130
                       79***************************.89***************8778899*************************************** PP

               NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++++ +glkktLvfy+g+apkg +t+W+m+eyrl
  Thecc1EG027945t1 131 ENSRSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 164
                       ********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.76838185IPR003441NAC domain
SuperFamilySSF1019417.72E-5638184IPR003441NAC domain
PfamPF023655.7E-2540164IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MAIAAAATMS NDPNDNNNND DHNNSSSSSK DDHEHDMVMP GFRFHPTEEE LVEFYLRRKV  60
EGKRFNVELI TFLDLYRYDP WELPALAAIG EKEWFFYVPR DRKYRNGDRP NRVTTSGYWK  120
ATGADRMIRA ENSRSIGLKK TLVFYSGKAP KGIRTSWIMN EYRLPQHETE RYQKAEISLC  180
RVYKRAGVED HPSLPRCLPT RPSASLRGQQ SGKKYPHDAA QQAMERFQGF GGQSQQMEIE  240
KISETDGSSS STSDVTTALG LSKQNVYRPM APISTTLGLP SGIEEEGMFL NQSKQGCSSL  300
VPNCTTVFTV GSSVSPNVVD DLHRLVSYQH ATMNQQQHYY SDHHHQQQQQ SEFSTLPPQS  360
QQLSLNMLPS SLPMAFSDRL WEWNPIPEAN REYNNPFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-544018519165NO APICAL MERISTEM PROTEIN
1ut4_B1e-544018519165NO APICAL MERISTEM PROTEIN
1ut7_A1e-544018519165NO APICAL MERISTEM PROTEIN
1ut7_B1e-544018519165NO APICAL MERISTEM PROTEIN
4dul_A1e-544018519165NAC domain-containing protein 19
4dul_B1e-544018519165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007023770.10.0PREDICTED: NAC domain-containing protein 35
SwissprotQ9ZVP81e-123NAC35_ARATH; NAC domain-containing protein 35
TrEMBLA0A061GB680.0A0A061GB68_THECC; NAC domain containing protein 35
STRINGEOY263920.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54362750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-113NAC domain containing protein 35
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  4. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]