PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG026767t1
Common NameTCM_026767
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family TALE
Protein Properties Length: 375aa    MW: 42028.1 Da    PI: 4.8652
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG026767t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.65e-093053382255
                       SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                        +yp++ee+ +L++ +gL+++q+ +WF N+R ++
  Thecc1EG026767t1 305 WPYPTEEEKLQLSEITGLDQKQINNWFINQRKRH 338
                       59*****************************885 PP

2ELK36.88.5e-13258279122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ++K +L+rKYsgyL+sL++EF+
  Thecc1EG026767t1 258 DIKGMLMRKYSGYLSSLRKEFL 279
                       58*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.7E-2163107IPR005540KNOX1
PfamPF037901.0E-2065106IPR005540KNOX1
SMARTSM012568.2E-27110161IPR005541KNOX2
PfamPF037914.4E-25113160IPR005541KNOX2
PROSITE profilePS5121310.58258278IPR005539ELK domain
SMARTSM011882.4E-6258279IPR005539ELK domain
PfamPF037891.3E-9258279IPR005539ELK domain
PROSITE profilePS5007112.633278341IPR001356Homeobox domain
SuperFamilySSF466893.17E-19280347IPR009057Homeodomain-like
SMARTSM003896.3E-13280345IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.5E-27283343IPR009057Homeodomain-like
CDDcd000861.03E-12290342No hitNo description
PfamPF059206.0E-17298337IPR008422Homeobox KN domain
PROSITE patternPS000270316339IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MEDMYRLDNP AISRSNDIVR VDNFAAANFS AAVTTDFLSP VDTILQFDHQ AADTDVTGSD  60
MSDLIKTQIA SHPRYPNLVS AYIECQKIGA PPELVSLLEE IGRENHPIRG CSEIGADPEL  120
DEFMESYCEV LHRYKEELSK PFDEATTFLS NIESQLSNLC KGALTKTLDY RSVNVVVEDS  180
NEFQSPATTV HSGRQLSRQT NFGLGFAYRL PFVHGEFCLT IKPKCSNEAA GTSEEELSGG  240
EVEASESQES AVARPSQDIK GMLMRKYSGY LSSLRKEFLK KRKKGKLPKD ARMTLLEWWN  300
NHYRWPYPTE EEKLQLSEIT GLDQKQINNW FINQRKRHWK PSEDMKFALF EGVAGNVGGP  360
VYLDAGVGTG SDNI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1273282LRKEFLKKRK
2279283KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00670PBMTransfer from GRMZM2G087741Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5831683e-43JX583168.1 Gossypium hirsutum clone NBRI_GE16149 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007031153.10.0KNOTTED1-like homeobox gene 6 isoform 1
SwissprotQ9FP293e-94KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A061F2Z60.0A0A061F2Z6_THECC; KNOTTED1-like homeobox gene 6 isoform 1
STRINGPOPTR_0005s01720.11e-144(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8352785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.12e-60KNOTTED-like from Arabidopsis thaliana
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]