PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG026389t4
Common NameTCM_026389
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family CPP
Protein Properties Length: 562aa    MW: 61883.9 Da    PI: 6.6179
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG026389t4genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.21e-15416453340
               TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       +k+CnCk+skClk+YC+Cfaag +C e C+C+dC+Nk 
  Thecc1EG026389t4 416 CKRCNCKRSKCLKLYCDCFAAGLYCIEPCSCQDCFNKP 453
                       89**********************************96 PP

2TCR54.52.3e-17500539140
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       ++k+gCnCkks+ClkkYCeCf+ag+ Cs +C+Ce+CkN+ 
  Thecc1EG026389t4 500 RHKRGCNCKKSSCLKKYCECFQAGVGCSPSCRCEGCKNRF 539
                       589***********************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.1E-18414455IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.591415540IPR005172CRC domain
PfamPF036383.7E-11417452IPR005172CRC domain
SMARTSM011142.8E-17500541IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.1E-13502538IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MDTPDKTQIT PTPSLSKFED SPVFKYINSL SPIELAKFRQ TDNAFNSLAF LSPSSLFPSP  60
QISCHRESRF SVKRHHFSAA SNSSVLQSSN DLNTDEGASK AIEQSYLYDE QPGCLNSGSS  120
SKGVSSDQLD DQSDLAIELP RTLKYDCGSP DGNLEPCDEI LKNTSEKVAG HEASPFQHNK  180
DEGEERQMSF ENERDLRKIR RIMRSEESAG CDWVAIVSDV ADLLTTNSSI IYENIEGQDR  240
RTADPGTTSF ISTILQFPLD NSNNLENTET GDPSGSCKQS KLGVPVTDQT PAILSTCLLD  300
KLVVSDSGLN KDDKGEKCNQ SSHQQRSIRR RCLVFEKSPG FGLHLNSLAN TSNDQSPLSK  360
LTPSTMKRDE VPHHNKAVVT DNSPETPATV SGNETDLNSP EKKRTKFEHV EENAACKRCN  420
CKRSKCLKLY CDCFAAGLYC IEPCSCQDCF NKPIHENKVL ETRRQIESRN PLAFAPKVIR  480
STDSVSDSGG ETNKTPASAR HKRGCNCKKS SCLKKYCECF QAGVGCSPSC RCEGCKNRFG  540
RKGGESLSGT VWLNTNINVW N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1941753712120Protein lin-54 homolog
5fd3_B2e-1941753712120Protein lin-54 homolog
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007030619.20.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X3
TrEMBLA0A061F2650.0A0A061F265_THECC; Tesmin/TSO1-like CXC domain-containing protein, putative isoform 4
STRINGEOY111180.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.13e-85Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]