PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG026389t3
Common NameTCM_026389
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family CPP
Protein Properties Length: 538aa    MW: 59450.2 Da    PI: 6.111
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG026389t3genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.39.6e-16416453340
               TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       +k+CnCk+skClk+YC+Cfaag +C e C+C+dC+Nk 
  Thecc1EG026389t3 416 CKRCNCKRSKCLKLYCDCFAAGLYCIEPCSCQDCFNKP 453
                       89**********************************96 PP

2TCR28.33.6e-09500525126
               TCR   1 kekkgCnCkkskClkkYCeCfaagkk 26 
                       ++k+gCnCkks+ClkkYCeCf+  ++
  Thecc1EG026389t3 500 RHKRGCNCKKSSCLKKYCECFQVCQF 525
                       589******************97665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.1E-18414455IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163428.612415537IPR005172CRC domain
PfamPF036383.5E-11417452IPR005172CRC domain
SMARTSM011146.1E-4500533IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.0E-5502524IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MDTPDKTQIT PTPSLSKFED SPVFKYINSL SPIELAKFRQ TDNAFNSLAF LSPSSLFPSP  60
QISCHRESRF SVKRHHFSAA SNSSVLQSSN DLNTDEGASK AIEQSYLYDE QPGCLNSGSS  120
SKGVSSDQLD DQSDLAIELP RTLKYDCGSP DGNLEPCDEI LKNTSEKVAG HEASPFQHNK  180
DEGEERQMSF ENERDLRKIR RIMRSEESAG CDWVAIVSDV ADLLTTNSSI IYENIEGQDR  240
RTADPGTTSF ISTILQFPLD NSNNLENTET GDPSGSCKQS KLGVPVTDQT PAILSTCLLD  300
KLVVSDSGLN KDDKGEKCNQ SSHQQRSIRR RCLVFEKSPG FGLHLNSLAN TSNDQSPLSK  360
LTPSTMKRDE VPHHNKAVVT DNSPETPATV SGNETDLNSP EKKRTKFEHV EENAACKRCN  420
CKRSKCLKLY CDCFAAGLYC IEPCSCQDCF NKPIHENKVL ETRRQIESRN PLAFAPKVIR  480
STDSVSDSGG ETNKTPASAR HKRGCNCKKS SCLKKYCECF QVCQFSSFCI EMFSSPI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1341752212105Protein lin-54 homolog
5fd3_B1e-1341752212105Protein lin-54 homolog
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017977418.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLA0A061F1A50.0A0A061F1A5_THECC; Tesmin/TSO1-like CXC domain-containing protein, putative isoform 3
STRINGEOY111180.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.14e-71Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]