PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG026030t2
Common NameTCM_026030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 357aa    MW: 40013.8 Da    PI: 8.1879
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG026030t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.45.6e-5381421128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+ +yLkkk++++++++ ++i++vdiyk++Pw+Lp+k++ +ekewyfFs+rd+ky++g r+nra++sgyWkatg+dk ++
  Thecc1EG026030t2   8 LPPGFRFHPTDEELILHYLKKKLSSSPFPV-SIIADVDIYKFDPWELPAKAAFGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKVIF 99 
                       79****************************.89***************988899*************************************** PP

               NAM  94 sk........kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++         +e++g+kk Lvfykgr pkg kt+W+mheyrl
  Thecc1EG026030t2 100 TSsmvaggggVQENIGVKKALVFYKGRPPKGIKTNWIMHEYRL 142
                       98788777655556***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-644175IPR003441NAC domain
PROSITE profilePS5100561.1518175IPR003441NAC domain
PfamPF023651.8E-279142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MKHPQSSLPP GFRFHPTDEE LILHYLKKKL SSSPFPVSII ADVDIYKFDP WELPAKAAFG  60
EKEWYFFSPR DRKYPNGARP NRAAASGYWK ATGTDKVIFT SSMVAGGGGV QENIGVKKAL  120
VFYKGRPPKG IKTNWIMHEY RLAENPNSNY NNRPVKSKDS SMRLDDWVLC RIYKKSHALS  180
STSTAAASDQ DQEEEETEQF IHDALLPALK SPPSNNTLQP QKSCSFSNLL DAMDYSLLSS  240
FLADNQCNTT GYESSSFSFG NLEQPPVNNY TNSSSSSSML LQKLPQLNSS IPNMENKLKR  300
QCTSIDEDYL HPSKKLISSC SYSNSASQSD MTQYNFLNQS FFNQSLLLSP HLQFQG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-73517514165NO APICAL MERISTEM PROTEIN
1ut4_B2e-73517514165NO APICAL MERISTEM PROTEIN
1ut7_A2e-73517514165NO APICAL MERISTEM PROTEIN
1ut7_B2e-73517514165NO APICAL MERISTEM PROTEIN
4dul_A2e-73517514165NAC domain-containing protein 19
4dul_B2e-73517514165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00333DAPTransfer from AT3G04070Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007030230.10.0PREDICTED: NAC transcription factor 29
SwissprotQ84TD61e-127NAC47_ARATH; NAC transcription factor 47
TrEMBLA0A061F2490.0A0A061F249_THECC; NAC domain containing protein 47, putative isoform 2
STRINGEOY107310.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.11e-115NAC domain containing protein 47
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Hofmann NR
    A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air.
    Plant Cell, 2013. 25(12): p. 4771
    [PMID:24363314]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]