PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG026028t1
Common NameTCM_026028
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 388aa    MW: 43540.7 Da    PI: 7.2022
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG026028t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM185.41.3e-57161431129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdee++++yL++kv ++++++ ++i evd++k+ePwdLpkk+k +ekewyfF++rd+ky+tg r+nrat++gyWkatgkdke++
  Thecc1EG026028t1  16 LPPGFRFHPTDEEIITHYLTEKVMNSNFSA-SAIGEVDLNKCEPWDLPKKAKMGEKEWYFFCQRDRKYPTGMRTNRATEAGYWKATGKDKEIY 107
                       79**************************99.88***************99999**************************************** PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       + kg lvg+kktLvfykgrapkgek++Wvmheyrle
  Thecc1EG026028t1 108 KGKGCLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 143
                       *9********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-6412168IPR003441NAC domain
PROSITE profilePS5100560.50316167IPR003441NAC domain
PfamPF023659.1E-3017142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MEEAIVVNKG EDLIDLPPGF RFHPTDEEII THYLTEKVMN SNFSASAIGE VDLNKCEPWD  60
LPKKAKMGEK EWYFFCQRDR KYPTGMRTNR ATEAGYWKAT GKDKEIYKGK GCLVGMKKTL  120
VFYKGRAPKG EKSNWVMHEY RLEGKFSYYN LPKGAKDEWV VCRVFHKNIG IKKPIPDQLL  180
RMNSFGDDLM DYASLPPLMD PTYSNKAGSS FTDGQNEFKA IDTTPMPRSS EGNYPGSSNF  240
PTMNNNQNFL QAPNNHYHQT GSSMFNPQIP IQNPILFHQG TPNSAYSHQG RTSGSASSNY  300
STGFGGNDQA ILRALAANNS ADTRKADRQC KVEQFSSNQS MVSLSQDTGL STEINNTEIS  360
SVLSKRMELG SSKSYEDIED LGCLWDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-531417315171NO APICAL MERISTEM PROTEIN
1ut4_B2e-531417315171NO APICAL MERISTEM PROTEIN
1ut7_A2e-531417315171NO APICAL MERISTEM PROTEIN
1ut7_B2e-531417315171NO APICAL MERISTEM PROTEIN
3swm_A2e-531417318174NAC domain-containing protein 19
3swm_B2e-531417318174NAC domain-containing protein 19
3swm_C2e-531417318174NAC domain-containing protein 19
3swm_D2e-531417318174NAC domain-containing protein 19
3swp_A2e-531417318174NAC domain-containing protein 19
3swp_B2e-531417318174NAC domain-containing protein 19
3swp_C2e-531417318174NAC domain-containing protein 19
3swp_D2e-531417318174NAC domain-containing protein 19
4dul_A2e-531417315171NAC domain-containing protein 19
4dul_B2e-531417315171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9141390.0JQ914139.1 Gossypium hirsutum NAC domain protein 8 (NAC8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007030224.10.0PREDICTED: NAC domain-containing protein 92
SwissprotQ9FK441e-121NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A061F1190.0A0A061F119_THECC; NAC domain protein, IPR003441, putative
STRINGEOY107260.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22692775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.11e-123Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]