PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG025670t1
Common NameTCM_025670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family M-type_MADS
Protein Properties Length: 234aa    MW: 26594.7 Da    PI: 9.1155
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG025670t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF59.15.3e-191152344
                      --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
            SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                      i  +s r+ tf kR++g+lKKA+ELS+LC+++++vii+s+ +
  Thecc1EG025670t1 11 ITKDSARKATFKKRKKGLLKKASELSTLCGIDASVIIYSPYN 52
                      778999*********************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-23160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.227149IPR002100Transcription factor, MADS-box
CDDcd002669.09E-19285No hitNo description
SuperFamilySSF554551.48E-24294IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-10323IPR002100Transcription factor, MADS-box
PfamPF003196.8E-191152IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MTRNTVKISY ITKDSARKAT FKKRKKGLLK KASELSTLCG IDASVIIYSP YNTQPEVWPS  60
PTEAERVLSK FKKMPKMDQS MEMMSQESFL KRRIELANKQ LKKQCRDNRE EEITQVMFQC  120
LAGQGLENLN MMDLNDLGWL LEQNMKDIDR RIYMLTKASH SQRSVAAASA TMATPEAMLK  180
SGEKVHVDSP EREVSPETEQ RQQLIKDLMH SPENIGLDSV LSFGDNNPIA FFP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12125KKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017976532.11e-159PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK32e-54AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A061F7211e-174A0A061F721_THECC; Agamous-like MADS-box protein A
STRINGEOY102991e-174(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.17e-36AGAMOUS-like 80
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]