PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG024695t1
Common NameTCM_024695
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 242aa    MW: 29016.5 Da    PI: 5.4239
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG024695t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM133.81.2e-41291552128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       ppG+rF P+deel+++yLk+kv ++++   ++i+ev++y+++P +L  +    +e+ewyfF++rd+k+++g r+nrat +g+Wk++g +k++ 
  Thecc1EG024695t1  29 PPGVRFFPSDEELLQHYLKNKVLNQPIFP-NIIQEVNLYQHHPLELTgMYKPLTETEWYFFTCRDRKHSKGCRPNRATPRGFWKQSGVEKPIP 120
                       9*************************877.79**************9333334788************************************* PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++ ++g kk L+fy++++++ ++tdW mheyr+
  Thecc1EG024695t1 121 LDSEDAIGYKKWLIFYEKENEQVKRTDWKMHEYRI 155
                       *9999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-5026184IPR003441NAC domain
PROSITE profilePS5100547.9928184IPR003441NAC domain
PfamPF023651.1E-2329155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEQNYQHNKL TKMQLDDATQ NDEYLNSFPP GVRFFPSDEE LLQHYLKNKV LNQPIFPNII  60
QEVNLYQHHP LELTGMYKPL TETEWYFFTC RDRKHSKGCR PNRATPRGFW KQSGVEKPIP  120
LDSEDAIGYK KWLIFYEKEN EQVKRTDWKM HEYRIHDTIS SPNKESAGNW LKVDGWVLCR  180
IFKKKEKNNE EETETFNPEV KDHDSIFDDY FSLTAENNFP YQKNNDCFDD LEEFDLKFFC  240
K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-362718514169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007028771.20.0PREDICTED: NAC transcription factor 56
TrEMBLA0A061EX881e-180A0A061EX88_THECC; NAC domain, IPR003441-like protein
STRINGEOY092730.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2388444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.12e-43NAC family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]