PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG024689t1
Common NameTCM_024689
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 330aa    MW: 37803.3 Da    PI: 4.8894
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG024689t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM143.11.5e-44421682128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       p G+rF P+deel+ +yLkkkv++++l+l + i+e+++y+ +P++L +++k  +e+ewyfF++r+kky++g+r+nrat +gyWk tg+dk++ 
  Thecc1EG024689t1  42 PFGYRFCPSDEELIEHYLKKKVNNETLPL-NRISEINLYSKDPSELAAEFKPlTETEWYFFTPRQKKYPNGSRPNRATPEGYWKPTGTDKAIP 133
                       88***************************.77**************9655543788************************************* PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +g+ +g kktL fy+g++p g+ktdW mhey++
  Thecc1EG024689t1 134 PGSGHPIGYKKTLDFYEGKHPGGRKTDWKMHEYKV 168
                       *9*******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-5339196IPR003441NAC domain
PROSITE profilePS5100551.96941196IPR003441NAC domain
PfamPF023653.4E-2542167IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MEQFHEQNSM QISAAAKGID VDPTCSRSDE TDLLEEYFNS FPFGYRFCPS DEELIEHYLK  60
KKVNNETLPL NRISEINLYS KDPSELAAEF KPLTETEWYF FTPRQKKYPN GSRPNRATPE  120
GYWKPTGTDK AIPPGSGHPI GYKKTLDFYE GKHPGGRKTD WKMHEYKVKD NTSQNNGRAK  180
NDMKLDDWVL CKLYNKKEKN GEDAGNSVTQ ATVIISQNEA SVMPERNNEF EDIASQPNPN  240
YGSLQHEDES SYGMYLMLSE PTAPILDNDI SFYSIEDCFP DVFDGQGSMF RDANKILLSS  300
WVIVKIVQVS FILTERYVKR VFLQSKLEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-504019714169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress (PubMed:18813954, PubMed:20632034). Induced by dehydration, cold stress and methyl jasmonate (PubMed:20632034). {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:20632034}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017976466.10.0PREDICTED: protein ATAF2
SwissprotQ52QH41e-52NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLA0A061EW220.0A0A061EW22_THECC; NAC domain, IPR003441-like protein
STRINGEOY092700.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1744279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.21e-53NAC domain containing protein 47
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Taga Y, et al.
    Role of OsHSP90 and IREN, Ca2+ dependent nuclease, in plant hypersensitive cell death induced by transcription factor OsNAC4.
    Plant Signal Behav, 2009. 4(8): p. 740-2
    [PMID:19820348]
  3. Xia N, et al.
    Characterization of a novel wheat NAC transcription factor gene involved in defense response against stripe rust pathogen infection and abiotic stresses.
    Mol. Biol. Rep., 2010. 37(8): p. 3703-12
    [PMID:20213512]
  4. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  5. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  6. Nakayama A, et al.
    Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice.
    BMC Plant Biol., 2013. 13: p. 150
    [PMID:24093634]
  7. Ootsubo Y,Hibino T,Wakazono T,Mukai Y,Che FS
    IREN, a novel EF-hand motif-containing nuclease, functions in the degradation of nuclear DNA during the hypersensitive response cell death in rice.
    Biosci. Biotechnol. Biochem., 2016. 80(4): p. 748-60
    [PMID:26766411]