PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG024217t1
Common NameTCM_024217
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 217aa    MW: 23409.3 Da    PI: 8.1528
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG024217t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.51.6e-4581071100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+ +
  Thecc1EG024217t1   8 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHPSQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQMD 100
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       l+ +k+e
  Thecc1EG024217t1 101 LSCAKSE 107
                       **99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.2677108IPR004883Lateral organ boundaries, LOB
PfamPF031957.3E-458105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MASSSNSPCA ACKFLRRKCQ PECVFAPYFP PDQPQKFANV HKVFGASNVT KLLNELHPSQ  60
REDAVNSLAY EADMRLRDPV YGCVGVISLL QHQLRQLQMD LSCAKSELSK YQSLGITGHA  120
GLIAAAAAAA TATANTHQNL GINLIGSGGG GGREHHYHHQ FFPRDHQQQM IRSFDAGSNY  180
DASLLAMNVS AGIGQLSQYQ QPRAAAGDDR RTIDPS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007028431.11e-161Lateral organ boundaries domain family protein
SwissprotO044799e-98LBD6_ARATH; LOB domain-containing protein 6
TrEMBLA0A061EW961e-161A0A061EW96_THECC; Lateral organ boundaries domain family protein
STRINGVIT_00s0340g00090.t011e-126(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM126792531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.47e-93LBD family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]