PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG022950t3
Common NameTCM_022950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family TALE
Protein Properties Length: 669aa    MW: 72283.5 Da    PI: 7.8736
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG022950t3genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093714081954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Thecc1EG022950t3 371 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 408
                       554459******************************88 PP

2BELL124.83.3e-40235306172
              BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       erqe+q+kkakL+s+l+eVd+rY+qy++q+q++issFe++ag+gsak Yt+lAlk+iS++FrcLkdai++qi
  Thecc1EG022950t3 235 ERQEIQMKKAKLISMLDEVDHRYRQYHHQMQIIISSFEQAAGIGSAKTYTALALKTISKQFRCLKDAITGQI 306
                       79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-66157304IPR006563POX domain
PfamPF075264.6E-50162303IPR006563POX domain
PROSITE profilePS5007112.195349412IPR001356Homeobox domain
CDDcd000863.82E-12352413No hitNo description
SMARTSM003895.3E-9352416IPR001356Homeobox domain
SuperFamilySSF466898.55E-17353418IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.6E-29355418IPR009057Homeodomain-like
PfamPF059202.7E-18369408IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MATYFHGNPE IQAPDGLQTL VLMNPAYVQY SDTAPPPANN LVFLNSNSLS PHAPSPHTQQ  60
FVGIPLPATS SANQDPSSHD ISPLHGLVQR VHYNLYNSID PSGGARDTPR AQQGLSLSLS  120
SQQHPGYGSQ AQAVSGEDMR VSGGSASSGS GVTNGVSGMQ SVLLSSKYLK AAQELLDEVV  180
NVNNTGITKS ELAKKGSGNN NNSSKAVGES LAVAGDGSGG GEAGGKRGAE LTTAERQEIQ  240
MKKAKLISML DEVDHRYRQY HHQMQIIISS FEQAAGIGSA KTYTALALKT ISKQFRCLKD  300
AITGQIRAAN KSLGEEDCLG GKIEGSRLKF VDHHLRQQRA LQQLGMIQHN AWRPQRGLPE  360
RSVSVLRAWL FEHFLHPYPK DSDKHMLAKQ TGLTRSQVSN WFINARVRLW KPMVEEMYLE  420
EVKEHEQNGS EDKSSKSQNN EDSASKSTAP EKSPANENHV KSLNSKQDNL TSQNASSMSI  480
STASTSPFAG NVRNQSGFSL IGSSELEGIT QGSPKKPRST ELLQSPSSVP SINIDIKQSE  540
ANNEVSMKFG KEGYSFMGTN TNFMGGFGQY PIGEIGRFDA EQFTPRFSGN GVSLTLGLPH  600
CENLSLSGTH QTLLPNPNLQ MGRRLDIGEP NEFATINPSA PHSSAAYENI SIQNRKRFAA  660
QLLPDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16358416563Homeobox protein Meis2
3k2a_B2e-16358416563Homeobox protein Meis2
4xrs_A2e-16358415158Homeobox protein Meis1
4xrs_B2e-16358415158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027982.10.0BEL1-like homeodomain protein 1 isoform 1
RefseqXP_007027983.10.0BEL1-like homeodomain protein 1 isoform 1
RefseqXP_007027984.10.0BEL1-like homeodomain protein 1 isoform 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A061EUI80.0A0A061EUI8_THECC; BEL1-like homeodomain protein 1 isoform 1
STRINGPOPTR_0006s21950.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-165BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]