PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG022798t3
Common NameTCM_022798
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family TCP
Protein Properties Length: 382aa    MW: 41512.2 Da    PI: 6.8455
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG022798t3genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP70.17e-223489358
               TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpa 58
                      ++++ + ++hTkv+gRdRR+R++++c   +F L++e G+ + ++ti+WLlqq+ p 
  Thecc1EG022798t3 34 KRRRDKGDRHTKVEGRDRRIRIPLTCCSGVFRLTREMGHRTHGQTIQWLLQQSRPD 89
                      5677788**********************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136916.8743993IPR017887Transcription factor TCP subgroup
PfamPF036341.8E-183988IPR005333Transcription factor, TCP
Gene3DG3DSA:3.60.110.103.7E-12111175IPR003010Carbon-nitrogen hydrolase
SuperFamilySSF563171.03E-40114353IPR003010Carbon-nitrogen hydrolase
PROSITE profilePS5026315.989115356IPR003010Carbon-nitrogen hydrolase
PfamPF007955.8E-11116189IPR003010Carbon-nitrogen hydrolase
PROSITE patternPS009200147162IPR000132Nitrilase/cyanide hydratase, conserved site
PfamPF007951.3E-20187336IPR003010Carbon-nitrogen hydrolase
Gene3DG3DSA:3.60.110.104.8E-28191337IPR003010Carbon-nitrogen hydrolase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0019499Biological Processcyanide metabolic process
GO:0051410Biological Processdetoxification of nitrogen compound
GO:0016021Cellular Componentintegral component of membrane
GO:0018822Molecular Functionnitrile hydratase activity
GO:0047427Molecular Functioncyanoalanine nitrilase activity
GO:0047558Molecular Function3-cyanoalanine hydratase activity
GO:0080061Molecular Functionindole-3-acetonitrile nitrilase activity
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MDSQTQTVDR QQQSFLPGTA KQEAGTLSLR PSKKRRRDKG DRHTKVEGRD RRIRIPLTCC  60
SGVFRLTREM GHRTHGQTIQ WLLQQSRPDL LLPDPMSCPS RLIGSAPDCM AKGRVRATVV  120
QASTVFLDTP ATLDKAERLI AGAAAYGSQL VVFPEAFVGG YPRGVSFEAV AVPSSTEDNE  180
VFLKYHASAI EVPVWCSGEK SSLPLYGTTI GKVGGLLYWD NRIPSLRTQL YDKGIEIYCA  240
PTADAREEWR ASMIHIAIEG RCFVLSANQF CQRKDYPLPL KCIDGDSNGD LSLDTIICSG  300
GSVIVSPSGT ILAGPNYHGE SLVSADLDLE EITRAKLEVS ETGHIVGPDS VGWAANRPNP  360
VIFPTAVKAE ALDELSWSPG L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3wuy_A5e-1711437615335Nitrilase
3wuy_B5e-1711437615335Nitrilase
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtHighly specific for beta-cyano-L-alanine (Ala(CN)). Low activity with 3-phenylpropionitrile (PPN). Not associated with auxin production but may be involved in cyanide detoxification (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027901.20.0PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4B isoform X3
SwissprotQ6H8492e-91NRL4_ORYSJ; Bifunctional nitrilase/nitrile hydratase NIT4
TrEMBLA0A061EUR90.0A0A061EUR9_THECC; Nitrilase 4 isoform 3
STRINGEOY084010.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.11e-18TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]