PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG022798t1
Common NameTCM_022798
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family TCP
Protein Properties Length: 440aa    MW: 48009 Da    PI: 7.8676
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG022798t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP69.88.7e-223489358
               TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpa 58
                      ++++ + ++hTkv+gRdRR+R++++c   +F L++e G+ + ++ti+WLlqq+ p 
  Thecc1EG022798t1 34 KRRRDKGDRHTKVEGRDRRIRIPLTCCSGVFRLTREMGHRTHGQTIQWLLQQSRPD 89
                      5677788**********************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.2E-183988IPR005333Transcription factor, TCP
PROSITE profilePS5136916.8743993IPR017887Transcription factor TCP subgroup
Gene3DG3DSA:3.60.110.106.5E-61114396IPR003010Carbon-nitrogen hydrolase
SuperFamilySSF563178.24E-60114411IPR003010Carbon-nitrogen hydrolase
CDDcd075642.66E-112115402No hitNo description
PROSITE profilePS5026336.281115414IPR003010Carbon-nitrogen hydrolase
PfamPF007951.2E-49116394IPR003010Carbon-nitrogen hydrolase
PROSITE patternPS009200147162IPR000132Nitrilase/cyanide hydratase, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0019499Biological Processcyanide metabolic process
GO:0051410Biological Processdetoxification of nitrogen compound
GO:0016021Cellular Componentintegral component of membrane
GO:0018822Molecular Functionnitrile hydratase activity
GO:0047427Molecular Functioncyanoalanine nitrilase activity
GO:0047558Molecular Function3-cyanoalanine hydratase activity
GO:0080061Molecular Functionindole-3-acetonitrile nitrilase activity
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MDSQTQTVDR QQQSFLPGTA KQEAGTLSLR PSKKRRRDKG DRHTKVEGRD RRIRIPLTCC  60
SGVFRLTREM GHRTHGQTIQ WLLQQSRPDL LLPDPMSCPS RLIGSAPDCM AKGRVRATVV  120
QASTVFLDTP ATLDKAERLI AGAAAYGSQL VVFPEAFVGG YPRGVSFEAV AVPSSTEDNE  180
VFLKYHASAI EVPGPEVDRL AKIAGKYKVY LVMGVVERAG FYLFSAILFF DSMGRYLGKH  240
RKLMPIASEC AVWCSGEKSS LPLYGTTIGK VGGLLYWDNR IPSLRTQLYD KGIEIYCAPT  300
ADAREEWRAS MIHIAIEGRC FVLSANQFCQ RKDYPLPLKC IDGDSNGDLS LDTIICSGGS  360
VIVSPSGTIL AGPNYHGESL VSADLDLEEI TRAKLEVSET GHIVGPDSVG WAANRPNPVI  420
FPTAVKAEAL DELSWSPGL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3wuy_A4e-3411443415335Nitrilase
3wuy_B4e-3411443415335Nitrilase
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtHighly specific for beta-cyano-L-alanine (Ala(CN)). Low activity with 3-phenylpropionitrile (PPN). Not associated with auxin production but may be involved in cyanide detoxification. {ECO:0000269|PubMed:10574458, ECO:0000269|PubMed:11060302}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced by abscisic acid or by 1-aminocyclopropane-1-carboxylic acid (ACC). {ECO:0000269|PubMed:10574458}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027899.20.0PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4B isoform X1
SwissprotQ429661e-135NRL4B_TOBAC; Bifunctional nitrilase/nitrile hydratase NIT4B
TrEMBLA0A061EUA70.0A0A061EUA7_THECC; Nitrilase 4 isoform 1
STRINGEOY084010.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2058756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.12e-18TCP family protein
Publications ? help Back to Top
  1. Dohmoto M,Sano J,Tsunoda H,Yamaguchi K
    Structural analysis of the TNIT4 genes encoding nitrilase-like protein from tobacco.
    DNA Res., 1999. 6(5): p. 313-7
    [PMID:10574458]
  2. Piotrowski M,Schönfelder S,Weiler EW
    The Arabidopsis thaliana isogene NIT4 and its orthologs in tobacco encode beta-cyano-L-alanine hydratase/nitrilase.
    J. Biol. Chem., 2001. 276(4): p. 2616-21
    [PMID:11060302]
  3. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]