PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG022690t1
Common NameTCM_022690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 256aa    MW: 28767.2 Da    PI: 6.7826
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG022690t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM138.15.4e-4341381127
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkk....leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                       +ppGfrF Pt+eel+++yL++k+e+++      +++vi+ v+iy+++PwdLp+     ++++ ++w+fF++r++++a+g r++r t++gyWka
  Thecc1EG022690t1   4 MPPGFRFYPTEEELISFYLHHKLESERedlsRLMDRVIPIVNIYEFNPWDLPQlslyLCHKDPEQWFFFIPRQESEARGGRPKRLTTTGYWKA 96 
                       79***********************996654223447***************656764445677***************************** PP

               NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                       tg+   v+s++++ +g+k+t+vfy+grap+g+kt+W m ey+
  Thecc1EG022690t1  97 TGSPGCVYSSTNRPIGVKRTMVFYNGRAPNGRKTEWKMIEYK 138
                       *****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-463166IPR003441NAC domain
PROSITE profilePS5100547.2884166IPR003441NAC domain
PfamPF023651.4E-215138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MEDMPPGFRF YPTEEELISF YLHHKLESER EDLSRLMDRV IPIVNIYEFN PWDLPQLSLY  60
LCHKDPEQWF FFIPRQESEA RGGRPKRLTT TGYWKATGSP GCVYSSTNRP IGVKRTMVFY  120
NGRAPNGRKT EWKMIEYKAI VEAAASSNGA TPTLRHEFSL CRVYKKSKCL RSFDRRPPAE  180
GVQIRDPAAD NQGQAAVGAA AACHQSPQMA ERTISSPESS SSGDHGNPSQ TGESSNSSAM  240
AVDFNEPFWD LLDGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-34316714169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027833.20.0PREDICTED: NAC domain-containing protein 90 isoform X1
TrEMBLA0A061ETF50.0A0A061ETF5_THECC; NAC domain containing protein 90
STRINGEOY083350.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101591034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.14e-70NAC domain containing protein 90
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]