PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG022676t1
Common NameTCM_022676
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 261aa    MW: 29707.2 Da    PI: 7.983
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG022676t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM145.13.8e-4541381127
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkk....leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                       +ppGfrF Pt+eelv++yL++k+egk+      +++vi+ vdiy+++PwdLp+     ++++ ++w+fF++r++++a+g r++r t+sgyWka
  Thecc1EG022676t1   4 MPPGFRFYPTEEELVSFYLHNKLEGKRedlnRLMDRVIPVVDIYDFNPWDLPHfsvyLCHKDPEQWFFFIPRQESEARGGRPKRLTTSGYWKA 96 
                       79*************************6653223347***************546653445667***************************** PP

               NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                       tg+   v+s++++ +g+k+t+vfy+grap+g+kt+W m+ey+
  Thecc1EG022676t1  97 TGSPGYVYSSNSRPIGVKRTMVFYNGRAPSGKKTEWKMNEYK 138
                       *****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-493166IPR003441NAC domain
PROSITE profilePS5100549.4484166IPR003441NAC domain
PfamPF023654.3E-235138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MEDMPPGFRF YPTEEELVSF YLHNKLEGKR EDLNRLMDRV IPVVDIYDFN PWDLPHFSVY  60
LCHKDPEQWF FFIPRQESEA RGGRPKRLTT SGYWKATGSP GYVYSSNSRP IGVKRTMVFY  120
NGRAPSGKKT EWKMNEYKAI EGEASSPNAA PPTLRQEFSL CRVYKKSKCL RSFDRRPPPG  180
VKIGEAVPRH GNGFGVGKSD HQGTEIADRT TIASSPESSS SGDNHHANRP NQTRESNSSR  240
MVVDDECSFW DLDGFWDPVN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-35416617165NO APICAL MERISTEM PROTEIN
1ut4_B1e-35416617165NO APICAL MERISTEM PROTEIN
1ut7_A1e-35416617165NO APICAL MERISTEM PROTEIN
1ut7_B1e-35416617165NO APICAL MERISTEM PROTEIN
4dul_A1e-35416617165NAC domain-containing protein 19
4dul_B1e-35416617165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027830.20.0PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR39e-70NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A061EV890.0A0A061EV89_THECC; NAC domain containing protein 90
STRINGEOY083320.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101591034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-71NAC domain containing protein 90
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]