PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG022126t1
Common NameTCM_022126
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 363aa    MW: 41161 Da    PI: 5.4992
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG022126t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1707.4e-53231501128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhP+deel+v+yLk+kv++++l++ ++i+e+d+yk++Pw+Lp+k+  +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++l
  Thecc1EG022126t1  23 LPPGFRFHPSDEELIVHYLKNKVTSSPLPA-SIIAEIDLYKYNPWELPSKALFGEDEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKPIL 114
                       79****************************.89***************87778999************************************* PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++ ++e +g+kk Lvfy+gr p+g+kt+W+mheyrl
  Thecc1EG022126t1 115 TScGTESIGVKKALVFYEGRPPRGTKTEWIMHEYRL 150
                       9988889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-6318177IPR003441NAC domain
PROSITE profilePS5100560.95323177IPR003441NAC domain
PfamPF023659.3E-2824150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MLAASASASA SSMEKTPGSE IQLPPGFRFH PSDEELIVHY LKNKVTSSPL PASIIAEIDL  60
YKYNPWELPS KALFGEDEWY FFSPRDRKYP NGARPNRAAA SGYWKATGTD KPILTSCGTE  120
SIGVKKALVF YEGRPPRGTK TEWIMHEYRL RETMIWTPKR KGSMRLDDWV LCRVRQKSST  180
QRNRLGDRDI TSHEPANSYL PKLNEVWLSN SNNPNVEMAE SYLFSDCPML PYIFASQNLP  240
CFDTTTSSIS FQNSDRSCTS AQEANSDTKK LQISFSSLES LFNPSKRKSM EGDNQATNFV  300
PPSKKLIWDE TEKEEVISLS NDCSDLNFYG TDHSEGNNFS PDQWNPIMQY QELNHLEFTE  360
AC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-71141808168NO APICAL MERISTEM PROTEIN
1ut4_B2e-71141808168NO APICAL MERISTEM PROTEIN
1ut7_A2e-71141808168NO APICAL MERISTEM PROTEIN
1ut7_B2e-71141808168NO APICAL MERISTEM PROTEIN
3swm_A2e-711418011171NAC domain-containing protein 19
3swm_B2e-711418011171NAC domain-containing protein 19
3swm_C2e-711418011171NAC domain-containing protein 19
3swm_D2e-711418011171NAC domain-containing protein 19
3swp_A2e-711418011171NAC domain-containing protein 19
3swp_B2e-711418011171NAC domain-containing protein 19
3swp_C2e-711418011171NAC domain-containing protein 19
3swp_D2e-711418011171NAC domain-containing protein 19
4dul_A2e-71141808168NAC domain-containing protein 19
4dul_B2e-71141808168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027296.20.0PREDICTED: NAC domain-containing protein 2 isoform X1
TrEMBLA0A061ET240.0A0A061ET24_THECC; NAC domain protein, IPR003441, putative
STRINGEOY077980.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17560810
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.16e-86NAC domain containing protein 25
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]