PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG022065t1
Common NameTCM_022065
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 475aa    MW: 51819.1 Da    PI: 8.9718
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG022065t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1048.2e-33196252360
                       -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geHnh+k
  Thecc1EG022065t1 196 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSF-DGQIAEIVYKGEHNHSK 252
                       9***************************************.***************85 PP

2WRKY106.11.9e-33393450259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        Dg++WrKYGqK+vkg+++prsYYrCts +C+v+k+ver+++dp+++++tYeg+Hnhe
  Thecc1EG022065t1 393 GDGFRWRKYGQKVVKGNPYPRSYYRCTSLKCNVRKHVERASDDPRAFITTYEGKHNHE 450
                       6********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.9E-30191253IPR003657WRKY domain
SuperFamilySSF1182901.16E-25193253IPR003657WRKY domain
SMARTSM007749.4E-37194252IPR003657WRKY domain
PROSITE profilePS5081123.732196253IPR003657WRKY domain
PfamPF031062.5E-25196250IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.7E-35377452IPR003657WRKY domain
SuperFamilySSF1182901.05E-28385452IPR003657WRKY domain
PROSITE profilePS5081135.117387452IPR003657WRKY domain
SMARTSM007744.3E-39392451IPR003657WRKY domain
PfamPF031062.9E-26394450IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MEVKEAERIV IAKPVASKPT CSSFKSFSEL LAGAINASPP NACSETAVPA IRPKTVRFKP  60
AVNQAPSAAA SSQAELPGIG VSSSSDKVLK SNVKPTVVYK PQAKLVSKTT VSLLANMGNF  120
SISNQQTLQS TEAPSQHTNQ EKKNFRSQVC PNFHQNAPSH AETDQTSEPS KVGSQNMEED  180
PKSLPAAANI DRPSYDGYNW RKYGQKQVKG SEYPRSYYKC THPNCPVKKK VERSFDGQIA  240
EIVYKGEHNH SKPQPPKRNS SGTQGLGFTS DGTGQDTNNS LWSNNPNERN EGSEGRVENQ  300
NEVGLSAPSS YQGKAVLSYE HVTTGAVNAG VTSENSIGLS GECEERSKEG EDDEPRSKRR  360
KSENQSSEVG TSGEGIQEPR VVVQSCTDSE IMGDGFRWRK YGQKVVKGNP YPRSYYRCTS  420
LKCNVRKHVE RASDDPRAFI TTYEGKHNHE MPLRNTNPVA SDPDSNSPAS KDKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-32196452877Probable WRKY transcription factor 4
2lex_A6e-32196452877Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Regulates trichome development, production of mucilage and tannin in seed coats, and maybe root hair development. {ECO:0000269|PubMed:12084832}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced by salicylic acid or wounding. {ECO:0000269|PubMed:12084832}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3311740.0AY331174.1 Theobroma cacao WRKY 13 (tcw13) gene, tcw13-1 allele, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017977336.10.0PREDICTED: WRKY transcription factor 44
SwissprotQ9ZUU01e-122WRK44_ARATH; WRKY transcription factor 44
TrEMBLA0A061ESU70.0A0A061ESU7_THECC; WRKY family transcription factor family protein
STRINGEOY076980.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83622740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.11e-122WRKY family protein
Publications ? help Back to Top
  1. Kim K,Jiang K,Teng SL,Feldman LJ,Huang H
    Using biologically interrelated experiments to identify pathway genes in Arabidopsis.
    Bioinformatics, 2012. 28(6): p. 815-22
    [PMID:22271267]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Simon M, et al.
    Tissue-specific profiling reveals transcriptome alterations in Arabidopsis mutants lacking morphological phenotypes.
    Plant Cell, 2013. 25(9): p. 3175-85
    [PMID:24014549]
  4. Ranocha P,Francoz E,Burlat V,Dunand C
    Expression of PRX36, PMEI6 and SBT1.7 is controlled by complex transcription factor regulatory networks for proper seed coat mucilage extrusion.
    Plant Signal Behav, 2014. 9(11): p. e977734
    [PMID:25531128]
  5. Verweij W, et al.
    Functionally Similar WRKY Proteins Regulate Vacuolar Acidification in Petunia and Hair Development in Arabidopsis.
    Plant Cell, 2016. 28(3): p. 786-803
    [PMID:26977085]
  6. Gonzalez A, et al.
    TTG2 controls the developmental regulation of seed coat tannins in Arabidopsis by regulating vacuolar transport steps in the proanthocyanidin pathway.
    Dev. Biol., 2016. 419(1): p. 54-63
    [PMID:27046632]
  7. Hassani-Pak K, et al.
    Developing integrated crop knowledge networks to advance candidate gene discovery.
    Appl Transl Genom, 2016. 11: p. 18-26
    [PMID:28018846]