PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG021350t1
Common NameTCM_021350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 458aa    MW: 50849.3 Da    PI: 5.7366
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG021350t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS273.56.7e-84644344374
              GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl....fsevsPil 91 
                       lLl+ A+ v+s+++e a+++L+    l+s++g+++qR+++yf +AL++++ + ++ +++ka +++  + ++ +e++ +l+      s   P++
  Thecc1EG021350t1  64 LLLASADKVDSRQFEHARKFLNLCDFLSSNAGSSIQRVVHYFSKALREKMDGeTGATTSKAGESRGGELSHPDETMVSLNPalitCSLKLPFV 156
                       799*************************************************66667777777776655553333333322322255567*** PP

              GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                       ++++++  qaI e v+++++vH iD+ i  G+Q  aL+qaLa+R+  +   l++T+vg    +s+++++etg+rLa+fAe+l++pf fn++++
  Thecc1EG021350t1 157 QVTQFAGLQAIIENVASAKKVHFIDLAIRSGAQCTALMQALATRDqCSIELLKVTAVGT---TSQTKMKETGKRLARFAEALNIPFLFNTVMV 246
                       *********************************************445569********...689**************************** PP

              GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                       ++l+d++ ++++++ +Ea++V++ + l ++l +s +les    ++++vk+l+P +vv++e eadh+s+ F+erf+eal++y++ fd+le  + 
  Thecc1EG021350t1 247 TDLKDISEDMFELNDDEAVVVSSRFLLRHTLTQSDCLES----IIRVVKNLNPCIVVITEFEADHTSPIFMERFSEALSFYTTYFDCLEDCFD 335
                       *******************************99999999....************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLv 368
                       r +++r+ +E+++lg ei+n va+e ++r+ r  + e Wr  l++ G+ +v+ls++   qa+l+  +++ ++  +   + +slv  Wk+ p++
  Thecc1EG021350t1 336 RCDQTRTILEAAYLGLEIRNTVAAEDEDRIFRDMKIEAWRTCLTNLGLVEVELSSSSLYQANLVATQFApGNTCTCCRNGKSLVVNWKGTPIL 428
                       *********************************************************************7777788899999*********** PP

              GRAS 369 svSaWr 374
                       s+S W+
  Thecc1EG021350t1 429 SLSTWK 434
                       *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.70935413IPR005202Transcription factor GRAS
PfamPF035142.3E-8164434IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MFYTSIMASI HGLSAASLIK IARASFNKIA SLEWFDLSVL NKFFNDGCFN LSGDEIKDVE  60
LAILLLASAD KVDSRQFEHA RKFLNLCDFL SSNAGSSIQR VVHYFSKALR EKMDGETGAT  120
TSKAGESRGG ELSHPDETMV SLNPALITCS LKLPFVQVTQ FAGLQAIIEN VASAKKVHFI  180
DLAIRSGAQC TALMQALATR DQCSIELLKV TAVGTTSQTK MKETGKRLAR FAEALNIPFL  240
FNTVMVTDLK DISEDMFELN DDEAVVVSSR FLLRHTLTQS DCLESIIRVV KNLNPCIVVI  300
TEFEADHTSP IFMERFSEAL SFYTTYFDCL EDCFDRCDQT RTILEAAYLG LEIRNTVAAE  360
DEDRIFRDMK IEAWRTCLTN LGLVEVELSS SSLYQANLVA TQFAPGNTCT CCRNGKSLVV  420
NWKGTPILSL STWKLFEQSK PRRNCNVKRK SLGDPAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-369143433375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007035777.20.0PREDICTED: DELLA protein RGL2
TrEMBLA0A061EPZ60.0A0A061EPZ6_THECC; GRAS family transcription factor, putative
STRINGEOY067030.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2576323
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.13e-53RGA-like 2
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]