PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG020677t2
Common NameTCM_020677
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family CPP
Protein Properties Length: 780aa    MW: 85028.1 Da    PI: 5.6165
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG020677t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR512.8e-16483521240
               TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                        +k+CnCkkskClk+YCeCfaag++C e C+C+dC+Nk 
  Thecc1EG020677t2 483 ACKRCNCKKSKCLKLYCECFAAGVYCIEPCSCQDCFNKP 521
                       589**********************************96 PP

2TCR50.44.3e-16568606139
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                       ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Thecc1EG020677t2 568 RHKRGCNCKKSSCLKKYCECYQGGVGCSINCRCEGCKNA 606
                       589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.5E-18482523IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.522483608IPR005172CRC domain
PfamPF036381.1E-11485520IPR005172CRC domain
SMARTSM011142.9E-17568609IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-11570606IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 780 aa     Download sequence    Send to blast
MDTPEKTQIS SSLSKFEDSP VFNYINSLSP IKPVKSVHLT QTFNPLSFAS LPSIFTSPHL  60
ISHKESRFLK SYTDTSKPEL SSGEGTKVST NEEAGVEAGQ LCGSSTELQE NFDPGVSLGE  120
ASLELPNEAS RFAIELPRTL KYDCGSPNCD PAPCVIETNC VSESNCASVS IVPFVQEASE  180
KGLSDGGVEV AGVCQIEQKR ENIGCDWENL ISDTADLLIF NSPNGSEAFR DVIQKSLDPD  240
TRFCATLISR FPQNDINEVS ETTIDSDKHK DPSLQTGEAV ELKEITHAHG NFENARLTNC  300
MSGSLTDNVE TGMCAPFSFK PGSNLHRGLR RRCLDFEMLA ARRKNLVDGS NTSSSVDNQF  360
VPSKPGNDSS RRILPGIGLH LNALATTSRD NKNIKHETLS SGTQKLSFPS STTSILLPTA  420
GQEAVHESLT SVSTERETDP VENGVQLAED ASQASAYLVN EEFNQNSPKK KRRRLEQAGE  480
TEACKRCNCK KSKCLKLYCE CFAAGVYCIE PCSCQDCFNK PIHEDTVLAT RKQIESRNPL  540
AFAPKVIRSS DSIPEVGDDS TKTPASARHK RGCNCKKSSC LKKYCECYQG GVGCSINCRC  600
EGCKNAFGRK DGSAIVETEE EPEEEETDPC DKNGVEKNLE KTDILDNEEQ NPVSALPTTP  660
LQLCRSLVQL PFSSKSKPPR SFIAIGSSST LYNGQRYGKP NIIRPQNIVE KHFQTVTEDE  720
MPEILRGNCS PGTGIKTSSP NSKRISPPQC ELGSTPGRRS GRKLILQSIP SFPSLTPQH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-1748560512120Protein lin-54 homolog
5fd3_B6e-1748560512120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1467474PKKKRRRL
2468473KKKRRR
3470474KRRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007034831.20.0PREDICTED: protein tesmin/TSO1-like CXC 2
TrEMBLA0A061EM970.0A0A061EM97_THECC; Tesmin/TSO1-like CXC domain-containing protein, putative isoform 2
STRINGEOY057570.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-175TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]