PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG019949t4
Common NameTCM_019949
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family Nin-like
Protein Properties Length: 959aa    MW: 104696 Da    PI: 4.9203
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG019949t4genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.82.5e-29553604152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Thecc1EG019949t4 553 AEKNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 604
                       589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.052536624IPR003035RWP-RK domain
PfamPF020422.5E-26556604IPR003035RWP-RK domain
SuperFamilySSF542772.13E-22854942No hitNo description
PROSITE profilePS5174520.626858940IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.7E-25858940No hitNo description
SMARTSM006661.0E-22858940IPR000270PB1 domain
PfamPF005648.8E-18859939IPR000270PB1 domain
CDDcd064073.30E-30859939No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 959 aa     Download sequence    Send to blast
MNFDSYAGWC NSPAATDQMF ASFGLSSYPS FPYASLDSLN ITEQSSGTFV EGGDALSGMG  60
GSYNCVDRMV CQQTDAQFGN PLDSTDTDEQ GVRRNNGGNR QNNTSDVANS LISRPIGQSL  120
DEKMLRALSL FKESSGGGIL AQVWVPVKHG DQYMLTTSDQ PYLLDQILSG YREVSRTYIF  180
SAELKLGSFP GLPGRVFISR VPEWTSNVTH YSEDEYLRFS HAVNHKVRGS IALPVFEPLE  240
MSCCAVLELV TVKEKPNFDA EMENVCLALQ AVNLRTTAPP RLLPQCLSRN QRAALAEITD  300
VLRAVCHAHR LPLALTWIPC NYAEEAVDEI IKVRVREGNK GWDGKCILCI EDTACYVNDT  360
EMQDFVHACA AHYLEEGQGI AGKALQSNHP FFSSDVKTYD ISDYPLVHHA RKFNLNAAVA  420
IRLRSTYTGD DDYILEFFLP INMKGSSEQQ LLLNNLSGTM QRICRSLRTV SDAEIVEGSK  480
VEFQRGTVPN FPPMSMSRRS SETALSAGSD MNSNDRIPLN VSNSRSDGKE ADGPPEQAMS  540
GPRRQMEKKR STAEKNVSLS VLQQYFSGSL KDAAKSIGVC PTTLKRICRQ HGISRWPSRK  600
INKVNRSLRK IQTVLDSVQG VEGGLKFDPA TGGFVAAGTI IQEFDSQKTL IFSENNLPVR  660
TPEPVNQEKP SAPLASCPDG ENSVVKLEED ECSFGGNNRG AAMSVVIPST CQELKKSSIP  720
SIDCSEDSKS VALDAGSFQA ASIGPAPWTC LENVTMGSYL PEGCDKWGLN KVNLKLEDSD  780
CHFVSRSSSS LAGADEMDAG MEGDDGIVEH NHQPTSSSMT DSSNGSGSML HGSSSSSQSF  840
EEAKNSKVKT ICVDSSSKIT VKATYKEDTV RFKFEPSAGC FQLYEEVATR FKIQNGTFQL  900
KYLDDEEEWV MLVSDSDLQE CLEILECVGT RNVKFQVRDV PCATGSSGSS NCFLGGGS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007033851.10.0Plant regulator RWP-RK family protein, putative isoform 4
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A061EK600.0A0A061EK60_THECC; Plant regulator RWP-RK family protein, putative isoform 4
STRINGPOPTR_0017s04980.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]