PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG019949t3
Common NameTCM_019949
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family Nin-like
Protein Properties Length: 895aa    MW: 97878.1 Da    PI: 5.2784
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG019949t3genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.92.3e-29489540152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Thecc1EG019949t3 489 AEKNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 540
                       589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.052472560IPR003035RWP-RK domain
PfamPF020422.3E-26492540IPR003035RWP-RK domain
SuperFamilySSF542771.93E-22790878No hitNo description
PROSITE profilePS5174520.626794876IPR000270PB1 domain
SMARTSM006661.0E-22794876IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.5E-25794876No hitNo description
CDDcd064074.68E-30795875No hitNo description
PfamPF005648.1E-18795875IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 895 aa     Download sequence    Send to blast
MLGGVTALQL QIRCLPPSDS TDTDEQGVRR NNGGNRQNNT SDVANSLISR PIGQSLDEKM  60
LRALSLFKES SGGGILAQVW VPVKHGDQYM LTTSDQPYLL DQILSGYREV SRTYIFSAEL  120
KLGSFPGLPG RVFISRVPEW TSNVTHYSED EYLRFSHAVN HKVRGSIALP VFEPLEMSCC  180
AVLELVTVKE KPNFDAEMEN VCLALQAVNL RTTAPPRLLP QCLSRNQRAA LAEITDVLRA  240
VCHAHRLPLA LTWIPCNYAE EAVDEIIKVR VREGNKGWDG KCILCIEDTA CYVNDTEMQD  300
FVHACAAHYL EEGQGIAGKA LQSNHPFFSS DVKTYDISDY PLVHHARKFN LNAAVAIRLR  360
STYTGDDDYI LEFFLPINMK GSSEQQLLLN NLSGTMQRIC RSLRTVSDAE IVEGSKVEFQ  420
RGTVPNFPPM SMSRRSSETA LSAGSDMNSN DRIPLNVSNS RSDGKEADGP PEQAMSGPRR  480
QMEKKRSTAE KNVSLSVLQQ YFSGSLKDAA KSIGVCPTTL KRICRQHGIS RWPSRKINKV  540
NRSLRKIQTV LDSVQGVEGG LKFDPATGGF VAAGTIIQEF DSQKTLIFSE NNLPVRTPEP  600
VNQEKPSAPL ASCPDGENSV VKLEEDECSF GGNNRGAAMS VVIPSTCQEL KKSSIPSIDC  660
SEDSKSVALD AGSFQAASIG PAPWTCLENV TMGSYLPEGC DKWGLNKVNL KLEDSDCHFV  720
SRSSSSLAGA DEMDAGMEGD DGIVEHNHQP TSSSMTDSSN GSGSMLHGSS SSSQSFEEAK  780
NSKVKTICVD SSSKITVKAT YKEDTVRFKF EPSAGCFQLY EEVATRFKIQ NGTFQLKYLD  840
DEEEWVMLVS DSDLQECLEI LECVGTRNVK FQVRDVPCAT GSSGSSNCFL GGGS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007033850.10.0Plant regulator RWP-RK family protein, putative isoform 3
SwissprotQ9M1B00.0NLP9_ARATH; Protein NLP9
TrEMBLA0A061EIU70.0A0A061EIU7_THECC; Plant regulator RWP-RK family protein, putative isoform 3
STRINGPOPTR_0017s04980.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]