PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG019949t2
Common NameTCM_019949
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family Nin-like
Protein Properties Length: 931aa    MW: 101717 Da    PI: 5.0249
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG019949t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.82.5e-29525576152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Thecc1EG019949t2 525 AEKNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 576
                       589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.052508596IPR003035RWP-RK domain
PfamPF020422.4E-26528576IPR003035RWP-RK domain
SuperFamilySSF542772.03E-22826914No hitNo description
SMARTSM006661.0E-22830912IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.6E-25830912No hitNo description
PROSITE profilePS5174520.626830912IPR000270PB1 domain
PfamPF005648.5E-18831911IPR000270PB1 domain
CDDcd064073.82E-30831911No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 931 aa     Download sequence    Send to blast
MNFDSYAGWC NSPAATDQMF ASFGGDALSG MGGSYNCVDR MVCQQTDAQF GNPLDSTDTD  60
EQGVRRNNGG NRQNNTSDVA NSLISRPIGQ SLDEKMLRAL SLFKESSGGG ILAQVWVPVK  120
HGDQYMLTTS DQPYLLDQIL SGYREVSRTY IFSAELKLGS FPGLPGRVFI SRVPEWTSNV  180
THYSEDEYLR FSHAVNHKVR GSIALPVFEP LEMSCCAVLE LVTVKEKPNF DAEMENVCLA  240
LQAVNLRTTA PPRLLPQCLS RNQRAALAEI TDVLRAVCHA HRLPLALTWI PCNYAEEAVD  300
EIIKVRVREG NKGWDGKCIL CIEDTACYVN DTEMQDFVHA CAAHYLEEGQ GIAGKALQSN  360
HPFFSSDVKT YDISDYPLVH HARKFNLNAA VAIRLRSTYT GDDDYILEFF LPINMKGSSE  420
QQLLLNNLSG TMQRICRSLR TVSDAEIVEG SKVEFQRGTV PNFPPMSMSR RSSETALSAG  480
SDMNSNDRIP LNVSNSRSDG KEADGPPEQA MSGPRRQMEK KRSTAEKNVS LSVLQQYFSG  540
SLKDAAKSIG VCPTTLKRIC RQHGISRWPS RKINKVNRSL RKIQTVLDSV QGVEGGLKFD  600
PATGGFVAAG TIIQEFDSQK TLIFSENNLP VRTPEPVNQE KPSAPLASCP DGENSVVKLE  660
EDECSFGGNN RGAAMSVVIP STCQELKKSS IPSIDCSEDS KSVALDAGSF QAASIGPAPW  720
TCLENVTMGS YLPEGCDKWG LNKVNLKLED SDCHFVSRSS SSLAGADEMD AGMEGDDGIV  780
EHNHQPTSSS MTDSSNGSGS MLHGSSSSSQ SFEEAKNSKV KTICVDSSSK ITVKATYKED  840
TVRFKFEPSA GCFQLYEEVA TRFKIQNGTF QLKYLDDEEE WVMLVSDSDL QECLEILECV  900
GTRNVKFQVR DVPCATGSSG SSNCFLGGGS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007033849.10.0Plant regulator RWP-RK family protein, putative isoform 2
SwissprotQ9M1B00.0NLP9_ARATH; Protein NLP9
TrEMBLA0A061EIE40.0A0A061EIE4_THECC; Plant regulator RWP-RK family protein, putative isoform 2
STRINGPOPTR_0017s04980.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]