PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG018809t1
Common NameTCM_018809
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family TCP
Protein Properties Length: 367aa    MW: 40293.7 Da    PI: 8.6957
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG018809t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP112.75.1e-35481902136
               TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksa 94 
                        g+kdrhsk++T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl++ak++i+el+ ++ ++ +++ +++ + s+s++  +++++++
  Thecc1EG018809t1  48 FGGKDRHSKVCTIRGLRDRRVRLSVPTAIQLYDLQDRLGLNQPSKVVDWLLNAAKHEIDELPPLPVPPGNFSLNHQMVLSTSQEAGASQSNKE 140
                       689******************************************************************999777777777755555333333 PP

               TCP  95 a.kskksqksaasalnlakesr...........akarararertrekmriknkl 136
                         k+++s + +     +   sr           ak+++ +re t+ek + ++++
  Thecc1EG018809t1 141 GiKTSSSVNWED----PGGLSRssfwssdafwrAKSKEVERETTNEKDNWNKRN 190
                       323333333222....22222222344455555999999***999999988655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-3050192IPR005333Transcription factor, TCP
PROSITE profilePS5136931.46950108IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0031347Biological Processregulation of defense response
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:0009507Cellular Componentchloroplast
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MIASSKEADS PARQEGNTND TKFNKGPSSS SPWLRLKDPR IVRVSRAFGG KDRHSKVCTI  60
RGLRDRRVRL SVPTAIQLYD LQDRLGLNQP SKVVDWLLNA AKHEIDELPP LPVPPGNFSL  120
NHQMVLSTSQ EAGASQSNKE GIKTSSSVNW EDPGGLSRSS FWSSDAFWRA KSKEVERETT  180
NEKDNWNKRN EEEKQGGSEG HHGAQVSSDS LLQRANHSSL PALLNNAMPY GSYYHFEPSN  240
FPLAHLGSHG FGSHAEDLHN FNVVPLPSTL SLSSGSQILV CPPGATQPLF PPHATASLEI  300
DPRQQVNHFQ MLSSGAQNLL PNSLNPPPYS IGQSTRPFHL SMTPRLPHSH NSSGSQPDKQ  360
QEFPSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-1855109155Putative transcription factor PCF6
5zkt_B2e-1855109155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00326DAPTransfer from AT3G02150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4860982e-72AM486098.2 Vitis vinifera contig VV78X124714.9, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007032773.20.0PREDICTED: transcription factor TCP13
RefseqXP_007032774.20.0PREDICTED: transcription factor TCP13
RefseqXP_017975605.10.0PREDICTED: transcription factor TCP13
TrEMBLA0A061EN210.0A0A061EN21_THECC; Plastid transcription factor 1, putative isoform 1
STRINGEOY036990.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91342637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.24e-53plastid transcription factor 1
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]