PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG018667t1
Common NameTCM_018667
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 521aa    MW: 56458.9 Da    PI: 8.1607
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG018667t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.64.7e-32234291260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       +DgynWrKYGqK++kg e+prsYY+Ct+ +C+vkkkversa d++++ei+Y+g Hnhek
  Thecc1EG018667t1 234 EDGYNWRKYGQKPIKGCEYPRSYYKCTHLNCSVKKKVERSA-DGQITEIIYKGAHNHEK 291
                       8****************************************.***************85 PP

2WRKY107.28e-34406464159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++dpk+v++tYeg+Hnh+
  Thecc1EG018667t1 406 LDDGYRWRKYGQKVVKGNPHPRSYYKCTSAGCNVRKHVERASTDPKAVITTYEGKHNHD 464
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.8E-28226293IPR003657WRKY domain
PROSITE profilePS5081123.456228292IPR003657WRKY domain
SuperFamilySSF1182903.01E-25231292IPR003657WRKY domain
SMARTSM007745.2E-36233291IPR003657WRKY domain
PfamPF031061.4E-24234290IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.6E-37392466IPR003657WRKY domain
SuperFamilySSF1182901.29E-29398466IPR003657WRKY domain
PROSITE profilePS5081139.192401466IPR003657WRKY domain
SMARTSM007749.6E-40406465IPR003657WRKY domain
PfamPF031061.8E-26407464IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0031347Biological Processregulation of defense response
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MAEREAEQGT RSKLSALTRP TITLPPRPAM DGLFSSGSGL SPGPMTLVSA FFSDPDSTEH  60
KSFSQLLAGA MASPGARLPY NSMDGLFMEV GFKDGAEKSA GFKQSRPLNL AVARSPLFTV  120
PPGISPSGLL NSPGFFPLSP QSPFGISHQQ ALAQVTAQAA LAQSHVRAQA EYQTLSVAAP  180
SESLIHHPSF NSEETSQQMP PAASDPQSSA IEYSEASQSD RKNQPSVAVD KPAEDGYNWR  240
KYGQKPIKGC EYPRSYYKCT HLNCSVKKKV ERSADGQITE IIYKGAHNHE KPQPNKQGKG  300
GNDGNSISQA NSELGSQGVA GNLNKLSEIV PTHSIPRKNH ESAQVAVEIP SESEEGCDEE  360
SREERDDDEP NPKRRNAAGE SAVVLSHKTV TESKIIVQTR SEVDLLDDGY RWRKYGQKVV  420
KGNPHPRSYY KCTSAGCNVR KHVERASTDP KAVITTYEGK HNHDVPAARN SSHTAVNNSL  480
PQPKPHKVVA EGHSLLQKMD FLNNAQGPAV LRLKEEQIRV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-40234467878Probable WRKY transcription factor 4
2lex_A1e-40234467878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017975383.10.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9ZQ701e-146WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLA0A061EGN10.0A0A061EGN1_THECC; WRKY DNA-binding protein 3, putative
STRINGEOY035520.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15342792
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-112WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]