PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG017746t3
Common NameTCM_017746
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 626aa    MW: 67953.4 Da    PI: 6.4299
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG017746t3genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS250.75.7e-774036242236
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lLl+cAeavs++++e+a+++L +ls+l++p g++ qR+aayf eA++arl++s+ ++++ lp+ ++s  ++++ ++a+++f+ +sP++kfs
  Thecc1EG017746t3 403 LTLLLQCAEAVSANNFEEANRMLLELSQLSTPFGTSAQRVAAYFSEAMSARLVSSCLGISAELPSIPQS--HTQKMVSAFQVFNGISPFVKFS 493
                       579************************************************************999987..5899999*************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
                       h+taNqaI ea+e+eervHiiD+di+qGlQWp L++ LasRp+gpp++R+Tg+g     s e+le+tg+rL++fA++lg+pfef + va+++ 
  Thecc1EG017746t3 494 HFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPHVRLTGLGT----SLEALEATGKRLSDFADKLGLPFEFCP-VAEKVG 581
                       *******************************************************....9**************************.7***** PP

              GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsP 236
                       +le+e+L+v+++Ea+aV++    h+l+d ++s ++    +L+l+++  P
  Thecc1EG017746t3 582 NLEPERLNVSKREAVAVHWLQ--HSLYDVTGSDTN----TLWLLQGWHP 624
                       *******************99..999988888888....8888777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.602376625IPR005202Transcription factor GRAS
PfamPF035142.0E-74403624IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MAACDLVGEN GSEINGCSNS RESPVTSASN SSTSEGKMMR KRMASEIADY HRFPRRSLPS  60
HPPSENMGCS FLAAATTANN PNPLLNYSTM NMNTTIIPSA NLTAVTSGGP AFLCTTTSNI  120
TCIDNLSTTN PPPPAVCGFS GLPLFPPTDR NRNTVAASTT TATTAPVALT PISNSMDDTS  180
ATAWIDGIIR DLIHTSSNVS IPQLIQNVRE IIYPCNPNLA ALLEYRLRSL MDPLERRRKE  240
TPPVHLPAGL IPRHHSQHQQ QQHGSSGLTL NLDSALDSVP NYSFTESCAM SQYLNWGITP  300
LPISNSAATG SNQHHHNQIS SSPSAPTPPV LSLNQTQHQP QVPHQAQEQP LPEENSSPVE  360
KTTTSTTTTT PTSTVQAVQA CSVRDRKEEL RQQKRDEEGL HLLTLLLQCA EAVSANNFEE  420
ANRMLLELSQ LSTPFGTSAQ RVAAYFSEAM SARLVSSCLG ISAELPSIPQ SHTQKMVSAF  480
QVFNGISPFV KFSHFTANQA IQEAFEREER VHIIDLDIMQ GLQWPGLFHI LASRPGGPPH  540
VRLTGLGTSL EALEATGKRL SDFADKLGLP FEFCPVAEKV GNLEPERLNV SKREAVAVHW  600
LQHSLYDVTG SDTNTLWLLQ GWHPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-1423866253244Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor involved in asymmetric cell division (By similarity). Required for differentiation of endodermis and graviresponses. {ECO:0000250, ECO:0000269|PubMed:16339910}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017975683.10.0PREDICTED: protein SCARECROW
SwissprotQ2Z2E91e-175SCR_IPONI; Protein SCARECROW
TrEMBLA0A061EDZ90.0A0A061EDZ9_THECC; GRAS family transcription factor isoform 3
STRINGEOY031730.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-141GRAS family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]