PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG017746t2
Common NameTCM_017746
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 778aa    MW: 84501 Da    PI: 6.3535
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG017746t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS418.55.7e-1284037602374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lLl+cAeavs++++e+a+++L +ls+l++p g++ qR+aayf eA++arl++s+ ++++ lp+ ++s  ++++ ++a+++f+ +sP++kfs
  Thecc1EG017746t2 403 LTLLLQCAEAVSANNFEEANRMLLELSQLSTPFGTSAQRVAAYFSEAMSARLVSSCLGISAELPSIPQS--HTQKMVSAFQVFNGISPFVKFS 493
                       579************************************************************999987..5899999*************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
                       h+taNqaI ea+e+eervHiiD+di+qGlQWp L++ LasRp+gpp++R+Tg+g     s e+le+tg+rL++fA++lg+pfef + va+++ 
  Thecc1EG017746t2 494 HFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPHVRLTGLGT----SLEALEATGKRLSDFADKLGLPFEFCP-VAEKVG 581
                       *******************************************************....9**************************.7***** PP

              GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                       +le+e+L+v+++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq+++h ++sFl  f+ea++yysalfdsl a++++ese
  Thecc1EG017746t2 582 NLEPERLNVSKREAVAVHWLQ--HSLYDVTGSDTN----TLWLLQRLAPKVVTVVEQDLSH-AGSFLGTFVEAIHYYSALFDSLGASYGEESE 667
                       ********************9..999999999999....**********************.899**************************** PP

              GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       er++vE++ll++ei+nv+a  g +r e+ + +++Wre+l+++GFk ++l  +aa+qa lll +++sdgy++ e++g+l lgWkd  L+++SaW
  Thecc1EG017746t2 668 ERHVVEQQLLSKEIRNVLALGGPSRSEEVK-FHNWREKLQQSGFKGISLAGNAATQATLLLGMFPSDGYTLVEDNGALKLGWKDLCLLTASAW 759
                       ************************999887.************************************************************** PP

              GRAS 374 r 374
                       r
  Thecc1EG017746t2 760 R 760
                       8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.519376740IPR005202Transcription factor GRAS
PfamPF035142.0E-125403760IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 778 aa     Download sequence    Send to blast
MAACDLVGEN GSEINGCSNS RESPVTSASN SSTSEGKMMR KRMASEIADY HRFPRRSLPS  60
HPPSENMGCS FLAAATTANN PNPLLNYSTM NMNTTIIPSA NLTAVTSGGP AFLCTTTSNI  120
TCIDNLSTTN PPPPAVCGFS GLPLFPPTDR NRNTVAASTT TATTAPVALT PISNSMDDTS  180
ATAWIDGIIR DLIHTSSNVS IPQLIQNVRE IIYPCNPNLA ALLEYRLRSL MDPLERRRKE  240
TPPVHLPAGL IPRHHSQHQQ QQHGSSGLTL NLDSALDSVP NYSFTESCAM SQYLNWGITP  300
LPISNSAATG SNQHHHNQIS SSPSAPTPPV LSLNQTQHQP QVPHQAQEQP LPEENSSPVE  360
KTTTSTTTTT PTSTVQAVQA CSVRDRKEEL RQQKRDEEGL HLLTLLLQCA EAVSANNFEE  420
ANRMLLELSQ LSTPFGTSAQ RVAAYFSEAM SARLVSSCLG ISAELPSIPQ SHTQKMVSAF  480
QVFNGISPFV KFSHFTANQA IQEAFEREER VHIIDLDIMQ GLQWPGLFHI LASRPGGPPH  540
VRLTGLGTSL EALEATGKRL SDFADKLGLP FEFCPVAEKV GNLEPERLNV SKREAVAVHW  600
LQHSLYDVTG SDTNTLWLLQ RLAPKVVTVV EQDLSHAGSF LGTFVEAIHY YSALFDSLGA  660
SYGEESEERH VVEQQLLSKE IRNVLALGGP SRSEEVKFHN WREKLQQSGF KGISLAGNAA  720
TQATLLLGMF PSDGYTLVED NGALKLGWKD LCLLTASAWR PFYASAASAT TIHRCSH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A0.03867613380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor involved in asymmetric cell division (By similarity). Required for differentiation of endodermis and graviresponses. {ECO:0000250, ECO:0000269|PubMed:16339910}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017975683.10.0PREDICTED: protein SCARECROW
SwissprotQ2Z2E90.0SCR_IPONI; Protein SCARECROW
TrEMBLA0A061EF070.0A0A061EF07_THECC; GRAS family transcription factor isoform 1
TrEMBLA0A061ELM00.0A0A061ELM0_THECC; GRAS family transcription factor isoform 2
STRINGEOY031730.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]