PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG017681t2
Common NameTCM_017681
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 556aa    MW: 62681.7 Da    PI: 4.9488
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG017681t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM41.34.7e-1333299128
               NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                       +vg+kktLv+y+grap+g++tdWvmheyrl
  Thecc1EG017681t2   3 AVGMKKTLVYYRGRAPHGTRTDWVMHEYRL 32 
                       69**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100522.675155IPR003441NAC domain
SuperFamilySSF1019414.45E-17355IPR003441NAC domain
PfamPF023653.0E-5432IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MRAVGMKKTL VYYRGRAPHG TRTDWVMHEY RLDERECETP SGLQDAYALC RVFKKSATGP  60
KIGEHYLATT ANQITSEHSS SIELYSEGRC DESSDFAIPL DTCSPSILNR SAIDICEARD  120
AKWMQSLSED AFGLSNPPSF SSYGTLPYPP SKVDVALECA RLQHRLSLPP LEVQDFPQVG  180
LTDYKVMRTT PMRESQHETD ILREILSVAH ASQELINPTG QQDAWGGSSS NANDFTFMTA  240
DDYMSRYSLE ESSTRSIDIS EVHLGDLKAE RMVENLRWVG MSSKDMEQQY CFMEETKIVP  300
IENISSFTRN ECNGIQGESG HNNNCDGFID TKINDPEIED FPQGFMDDDP NEHFLDEGNI  360
DDLTSSPSFE VVEDIKINHG MFVSTRQVAE TFFHQIVPSQ TVKVHQNPVI ATSFVLGKAE  420
SHETRYNKGN SFFRKFNACA SGKFMEIITF TEPCKKTASA FLWIVVLLLM HGFYLEEDIT  480
NEKLMDGLSA KETKEKALTV MSITGKPRTK WNKKKEKYSL VKASTWNDFG WLLTKLGFFL  540
TISLVLCTLL ASTLY*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017974318.10.0PREDICTED: NAC domain-containing protein 86
TrEMBLA0A061EDZ10.0A0A061EDZ1_THECC; NAC domain containing protein 28, putative isoform 2
STRINGEOY031350.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.12e-93NAC domain containing protein 28
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]