PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG017681t1
Common NameTCM_017681
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 656aa    MW: 74397.1 Da    PI: 5.554
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG017681t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM183.26.1e-5761331128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppGfrFhPtdeelvv+yLk+k++g+k+el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratksgyWkatgkd++
  Thecc1EG017681t1   6 LPPGFRFHPTDEELVVYYLKRKINGRKIEL-EIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKSGYWKATGKDRK 97 
                       79****************************.99***************6434555777*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       v s + ++vg+kktLv+y+grap+g++tdWvmheyrl
  Thecc1EG017681t1  98 VNS-QMRAVGMKKTLVYYRGRAPHGTRTDWVMHEYRL 133
                       ***.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.19E-644156IPR003441NAC domain
PROSITE profilePS5100561.9076156IPR003441NAC domain
PfamPF023653.9E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV VYYLKRKING RKIELEIIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKSGYWK ATGKDRKVNS QMRAVGMKKT LVYYRGRAPH  120
GTRTDWVMHE YRLDERECET PSGLQDAYAL CRVFKKSATG PKIGEHYLAT TANQITSEHS  180
SSIELYSEGR CDESSDFAIP LDTCSPSILN RSAIDICEAR DAKWMQSLSE DAFGLSNPPS  240
FSSYGTLPYP PSKVDVALEC ARLQHRLSLP PLEVQDFPQV GLTDYKVMRT TPMRESQHET  300
DILREILSVA HASQELINPT GQQDAWGGSS SNANDFTFMT ADDYMSRYSL EESSTRSIDI  360
SEVHLGDLKA ERMVENLRWV GMSSKDMEQY CFMEETKIVP IENISSFTRN ECNGIQGESG  420
HNNNCDGFID TKINDPEIED FPQGFMDDDP NEHFLDEGNI DDLTSSPSFE VVEDIKINHG  480
MFVSTRQVAE TFFHQIVPSQ TVKVHQNPVI ATSFVLGKAE SHETRYNKGN SFFRKFNACA  540
SGKFMEIITF TEPCKKTASA FLWIVVLLLM HGFYLEEDIT NEKLMDGLSA KETKEKALTV  600
MSITGKPRTK WNKKKEKYSL VKASTWNDFG WLLTKLGFFL TISLVLCTLL ASTLY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-57116212171NO APICAL MERISTEM PROTEIN
1ut4_B2e-57116212171NO APICAL MERISTEM PROTEIN
1ut7_A2e-57116212171NO APICAL MERISTEM PROTEIN
1ut7_B2e-57116212171NO APICAL MERISTEM PROTEIN
3swm_A2e-57116215174NAC domain-containing protein 19
3swm_B2e-57116215174NAC domain-containing protein 19
3swm_C2e-57116215174NAC domain-containing protein 19
3swm_D2e-57116215174NAC domain-containing protein 19
3swp_A2e-57116215174NAC domain-containing protein 19
3swp_B2e-57116215174NAC domain-containing protein 19
3swp_C2e-57116215174NAC domain-containing protein 19
3swp_D2e-57116215174NAC domain-containing protein 19
4dul_A2e-57116212171NAC domain-containing protein 19
4dul_B2e-57116212171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017974318.10.0PREDICTED: NAC domain-containing protein 86
TrEMBLA0A061EDT40.0A0A061EDT4_THECC; NAC domain protein, IPR003441, putative isoform 1
STRINGEOY031350.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101122632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-173NAC domain containing protein 28
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]