PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG017048t1
Common NameTCM_017048
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 412aa    MW: 47027.6 Da    PI: 4.7372
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG017048t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM143.51.1e-44271551128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       lppG+ F+P+d+el+v+yL+++v +k+l+  + ikev++yk+ P dL +   + +++ +ewyfF++rd+ky +g+r++r++ +g+Wkatg+d+
  Thecc1EG017048t1  27 LPPGYCFKPRDDELIVHYLRRRVCNKPLPP-NRIKEVELYKYSPDDLTQadnASSQKVSEWYFFTPRDRKYVNGSRPSRTAGDGFWKATGSDT 118
                       79*************************999.77**************843433344566********************************** PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +v+  kg+ vg kktLv+y g+ pkgekt+W+mhey l
  Thecc1EG017048t1 119 SVMF-KGNIVGFKKTLVYYYGKPPKGEKTNWIMHEYVL 155
                       ****.999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.09E-5025181IPR003441NAC domain
PROSITE profilePS5100550.70827182IPR003441NAC domain
PfamPF023652.2E-2328155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MSPAMKEAKP TPNLPVFINA EDFLDSLPPG YCFKPRDDEL IVHYLRRRVC NKPLPPNRIK  60
EVELYKYSPD DLTQADNASS QKVSEWYFFT PRDRKYVNGS RPSRTAGDGF WKATGSDTSV  120
MFKGNIVGFK KTLVYYYGKP PKGEKTNWIM HEYVLSNPPA RQRAGKDDMR LDDWVLCRLH  180
NRNDTKVGAT QQATDQKQEE ENYAIVAAQT EILEQQYDEN ILPLQIEIPV AQAEILEQQY  240
GKILPPQTEQ VQVQDFNLLL PQQTCSMPLY NPYDDSTSGF TSFPESLHPM LEYHSTMFPQ  300
QDVSVYGNII TTVAPIATIP PPQFQHSQQQ QFSRAPNIHD PLNMHQQQQF SGAPNFPDPS  360
NMDQQQQQFS GGPNIHGPLN MHQQEQQFSD APDITELLAA DQYLLDMDHD E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-502618414170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017974441.10.0PREDICTED: NAC transcription factor 29
TrEMBLA0A061EDC40.0A0A061EDC4_THECC; NAC domain protein
STRINGEOY026230.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.12e-52NAC family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]