PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG016952t1
Common NameTCM_016952
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 173aa    MW: 18836.1 Da    PI: 7.3364
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG016952t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.21.8e-4510108199
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++p+++reda++sl+yeAear++dPvyG+vg i+ lq+q+++l+ e
  Thecc1EG016952t1  10 PCAACKFLRRKCMPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVPPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVMRLQRE 102
                       7******************************************************************************************** PP

            DUF260  94 lallke 99 
                       l+++++
  Thecc1EG016952t1 103 LDATNA 108
                       *99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089128.0419110IPR004883Lateral organ boundaries, LOB
PfamPF031956.3E-4510107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MASSSYSNSP CAACKFLRRK CMPDCIFAPY FPPEEPQKFA NVHKIFGASN VSKLLNEVPP  60
HQREDAVNSL AYEAEARMKD PVYGCVGAIS VLQRQVMRLQ RELDATNADL IRFACNEMPP  120
ASISQYGRRT GHHGGAAGAA SFNQNSGYYY PSQWNSDDPC GDNERSSGGG SM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007031563.11e-128Lateral organ boundaries domain family protein
SwissprotQ8L8Q32e-70LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A061EJK71e-128A0A061EJK7_THECC; Lateral organ boundaries domain family protein
STRINGPOPTR_0001s35280.19e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.13e-71LOB domain-containing protein 25
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]