PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG016589t1
Common NameTCM_016589
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family G2-like
Protein Properties Length: 377aa    MW: 42231.1 Da    PI: 9.3768
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG016589t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.8e-32198251255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Thecc1EG016589t1 198 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 251
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15195251IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28196251IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-23198251IPR006447Myb domain, plants
PfamPF002492.5E-7199250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTWRRTEE DMDLGFWKRA LDSRNSVSSM AKTDNCFELS  60
LSNPRVSESN SNHLHLLQNG GANCNGNLFH TYHQNQFPHR HNQLQHPVLY QHQQQQQGLG  120
QELGFLRPIR GIPVYQNHPP PTPFPFAQQP LDSSLASSPS SLVTNNTSNT SLSPFQSQGL  180
MRSRFMSRFP AKRSMRAPRM RWTTTLHARF VHAVELLGGH ERATPKSVLE LMDVKDLTLA  240
HVKSHLQMYR TVKTTDRAAA SSGQSDAFEN GSSGDTSEDL MFDIQNPRRS EISVQQGRPS  300
SNAHQDKEYH GLWSNSSREA WLHGKPKDSA RNLPSLEKDM DPKCLSYERI SDVSSSSLSG  360
TSPKKPNLEF TLGVPH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007040692.10.0Homeodomain-like superfamily protein isoform 1
RefseqXP_007040693.10.0Homeodomain-like superfamily protein isoform 1
SwissprotQ9C6161e-102KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A061G7400.0A0A061G740_THECC; Homeodomain-like superfamily protein isoform 1
STRINGPOPTR_0001s02010.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-76G2-like family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]