PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG016315t3
Common NameTCM_016315
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family TALE
Protein Properties Length: 662aa    MW: 73792 Da    PI: 6.6766
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG016315t3genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.4e-094324691954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Thecc1EG016315t3 432 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 469
                       554459******************************88 PP

2BELL119.11.9e-38294364272
              BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       + elqk+k+kLls+leeVd+rY++y++q+++v+ssFeavag g+a +Y +lA+ka+SrhFrcL+d i++qi
  Thecc1EG016315t3 294 FIELQKRKTKLLSMLEEVDRRYRHYCDQMKAVVSSFEAVAGTGAASVYSALASKAMSRHFRCLRDGIVSQI 364
                       579*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.9E-61231362IPR006563POX domain
PfamPF075261.2E-47237360IPR006563POX domain
PROSITE profilePS5007112.179410473IPR001356Homeobox domain
CDDcd000862.57E-11413474No hitNo description
SMARTSM003895.8E-9413477IPR001356Homeobox domain
SuperFamilySSF466895.56E-17414479IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27416479IPR009057Homeodomain-like
PfamPF059208.9E-18430469IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MARELCEDKS RNMVSSTGFC YSDVSSGNAT MQTHLVNQIQ SFESNSEIFN LTTGMEMIGF  60
SKNLQQQGDS NTVMWKGFFN KHGTNPGPSS SKTISESTSD FYQHEFHKPE FTTGISETST  120
ENLIVGPESA PWQENRLLVD DSSLRCVFPC EGNERPSQGL SLSLSSSNPT SIGLQSFELR  180
QTSHSNHDQQ DDMRFIGSSS RDGFFGKPVN IQHQQQMIQD GFLGKAANLH HQGLFQLRSS  240
KYLGPAQELL NEFCSLGTKQ IDASKQKQIH KTKQWDDENG ASSSRKQALY SLDFIELQKR  300
KTKLLSMLEE VDRRYRHYCD QMKAVVSSFE AVAGTGAASV YSALASKAMS RHFRCLRDGI  360
VSQIQATRKA MGEKDPVAPG TTRGETPRLR VLDQALRQQK AFQQMSMMES HPWRPQRGLP  420
ERSVSVLRAW LFEHFLHPYP SDVDKHILAR QTGLSRSQVS NWFINARVRL WKPMVEEMYL  480
EEIKEHENNM ASSDGATDGD DNGRPNQNPP TDQKPTPDQL VRVDSECLSS IVTNPDKNDA  540
KSAKTLQNQH SHQPQNFGTY GAMELDFSSY SHHTAGGVSY GSDNANQNFN GGGVSLTLGL  600
QQHGGTGVSL AFSPASQSPL FYPRDHIEDC QQVQYSLLDG EGQHLPYRNL MGAQLLHDLA  660
G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B1e-15419476158Homeobox protein Meis1
4xrs_A1e-15419476158Homeobox protein Meis1
3k2a_B1e-15419477563Homeobox protein Meis2
3k2a_A1e-15419477563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6144975e-99JX614497.1 Gossypium hirsutum clone NBRI_GE57913 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007040322.10.0POX family protein isoform 1
RefseqXP_007040323.10.0POX family protein isoform 1
RefseqXP_007040324.10.0POX family protein isoform 1
RefseqXP_007040325.10.0POX family protein isoform 1
RefseqXP_007040326.10.0POX family protein isoform 1
SwissprotQ388971e-152BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A061G6K40.0A0A061G6K4_THECC; POX family protein isoform 1
STRINGPOPTR_0003s13120.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-145TALE family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]