PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG016035t2
Common NameTCM_016035
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 359aa    MW: 41573.4 Da    PI: 6.8388
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG016035t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.11.3e-5671361129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +ppGfrFhPtdeelv++yL+kkv++k+++l +vik+vd+yk+ePwdL++  ++ + e++ewyfFs++dkky+tg+r+nratk+g+Wkatg+dk
  Thecc1EG016035t2   7 VPPGFRFHPTDEELVDYYLRKKVASKRIDL-DVIKDVDLYKIEPWDLQElcRIGTeEQNEWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDK 98 
                       69****************************.9***************954555442556********************************** PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +++s +++l+g++ktLvfykgrap+g+k+dW+mheyrle
  Thecc1EG016035t2  99 AIYS-RHSLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                       ****.889*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-615156IPR003441NAC domain
PROSITE profilePS5100560.2877156IPR003441NAC domain
PfamPF023657.2E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MNTFTHVPPG FRFHPTDEEL VDYYLRKKVA SKRIDLDVIK DVDLYKIEPW DLQELCRIGT  60
EEQNEWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKAI YSRHSLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN GTPQEEGWVV CRVFKKRMTT VRKVGEYDSP CWYDDQVSFM  180
QDLDSPRRIP QPYASYHHHY PCKQELELQY NLPHDPFLQL PQLESPKVPQ SAASVSCNSV  240
VPYGYDRNNG STLQSSTLTQ EEHMQPGHQQ NLNSLYNNSE QAVDQVTDWR VLDKFVASQL  300
SHEEASKENN YPNAATSLQV AEQMNLLASE SKRPEIAHQE YASTSTSSCQ IDLVKKMN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-51615714169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472110.0KC847211.1 Gossypium hirsutum NAC domain protein NAC34 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017973363.10.0PREDICTED: NAC domain-containing protein 7
SwissprotQ9FWX21e-161NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A061G3J00.0A0A061G3J0_THECC; NAC domain protein, IPR003441 isoform 2
STRINGEOY244300.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21112678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-163NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]