PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG015956t1
Common NameTCM_015956
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family Nin-like
Protein Properties Length: 361aa    MW: 40874.1 Da    PI: 6.1841
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG015956t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.11.3e-26269318251
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 
                       + +++l+d++kyF+lpi++AA+ L++++TvLK+iCR+yG+ RWPhRki+s
  Thecc1EG015956t1 269 TRNLTLKDIEKYFHLPIEEAARRLDLSVTVLKKICRKYGVLRWPHRKIQS 318
                       689*********************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.791259339IPR003035RWP-RK domain
PfamPF020425.2E-23271318IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MEDPNSSVPN NNPNDMYPDG IFNFLDFENL VEDLTTQDIS VLSTFSIHDP SSEEIANDTI  60
DPLDDPVIRD FYNERNAGTS QAGFFGLSGV MNNPTEKNMG TESLNFENSM PLSVWPIEPV  120
PFGCSCCQVL REIVHTNGIN VTKLEIHGRL GIICHAILTD RSGSTNAVAP DHQYQMFDFC  180
KKSIQYVKQF LSQYCFHRSQ TGYVIVQDPL SGFYEALCVG FLWDENFNNG DFMQPSSSHA  240
GGFRMDQAGN SNNQGKHPKP SLSIQRERTR NLTLKDIEKY FHLPIEEAAR RLDLSVTVLK  300
KICRKYGVLR WPHRKIQSME KQIVFWTGKL NSNDPEERDR AAKIILKLQR GIAKIREGAR  360
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039825.10.0Uncharacterized protein TCM_015956
TrEMBLA0A061G4260.0A0A061G426_THECC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40762342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.15e-13RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]