PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG015749t1
Common NameTCM_015749
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 339aa    MW: 38372.5 Da    PI: 4.815
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG015749t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.81.8e-5261331128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppGfrFhPtdeel+ +yLk+k+eg++lel evi+ +d+yk++Pw+Lp k  + +++ ew+fF++rd+ky++g+r+nratk+gyWkatgkd++
  Thecc1EG015749t1   6 LPPGFRFHPTDEELIGYYLKRKTEGQELEL-EVIPVIDLYKFDPWELPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATKAGYWKATGKDRK 97 
                       79***************************9.99**************95334445667*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       v++ +++++g +ktLvfy grap g +t Wvmheyrl
  Thecc1EG015749t1  98 VVC-QSAVTGYRKTLVFYLGRAPLGDRTGWVMHEYRL 133
                       ***.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-604155IPR003441NAC domain
PROSITE profilePS5100558.3786155IPR003441NAC domain
PfamPF023651.7E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGGASLPPGF RFHPTDEELI GYYLKRKTEG QELELEVIPV IDLYKFDPWE LPEKSFLPKR  60
DLEWFFFCPR DRKYPNGSRT NRATKAGYWK ATGKDRKVVC QSAVTGYRKT LVFYLGRAPL  120
GDRTGWVMHE YRLSDEPSQG STNQGAFALC RVVKRNEQKA TDAHGEPKAT RIGSNSTNVE  180
LTSTRICNES LSIGDISCQT SYPNNESRCS SPTTSPYPYE VTQMQPFEPV SVDTDPASVW  240
VSPDLILDSS KDYPQICETA SQYFPQYEFP SSGTPWQQYD QTEFSPSSSY SNFGEIEHVD  300
DLSRMNCMSP YSGHANYMDF YGNEGYDQSG SFSYLNPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-54515616166NO APICAL MERISTEM PROTEIN
1ut4_B2e-54515616166NO APICAL MERISTEM PROTEIN
1ut7_A2e-54515616166NO APICAL MERISTEM PROTEIN
1ut7_B2e-54515616166NO APICAL MERISTEM PROTEIN
4dul_A2e-54515616166NAC domain-containing protein 19
4dul_B2e-54515616166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269|PubMed:21911380, ECO:0000269|PubMed:25182467, ECO:0000269|PubMed:27986917}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding in the flowering stem. {ECO:0000269|PubMed:21911380}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017972323.10.0PREDICTED: NAC domain-containing protein 86
SwissprotO496971e-109NAC71_ARATH; NAC domain-containing protein 71
TrEMBLA0A061GAH70.0A0A061GAH7_THECC; NAC domain protein, IPR003441
STRINGEOY240440.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21512777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-111NAC domain containing protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Asahina M,Satoh S
    Molecular and physiological mechanisms regulating tissue reunion in incised plant tissues.
    J. Plant Res., 2015. 128(3): p. 381-8
    [PMID:25736731]
  4. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]