PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG015584t2
Common NameTCM_015584
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 659aa    MW: 72758.7 Da    PI: 4.8955
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG015584t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.62.8e-54131392128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                       p GfrF+Ptdeel+++yLk k++g++ e+ evi+e+d++k+ePwdLp  + +k+++ ew+fF++rd+ky++g+r+nrat++gyWkatgkd+++
  Thecc1EG015584t2  13 PLGFRFRPTDEELINHYLKLKINGRHSEV-EVIPEIDVCKWEPWDLPglSVIKSDDPEWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTI 104
                       78************************999.99***************6447888888************************************ PP

               NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +s k++l+g+kktLvfykgrapkg++t+W+mheyr+
  Thecc1EG015584t2 105 KS-KKSLIGMKKTLVFYKGRAPKGQRTNWIMHEYRA 139
                       **.899****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.07E-6110162IPR003441NAC domain
PROSITE profilePS5100557.04612162IPR003441NAC domain
PfamPF023653.3E-2813138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MITSCLPSDV SSPLGFRFRP TDEELINHYL KLKINGRHSE VEVIPEIDVC KWEPWDLPGL  60
SVIKSDDPEW FFFCPRDRKY PNGHRSNRAT DKGYWKATGK DRTIKSKKSL IGMKKTLVFY  120
KGRAPKGQRT NWIMHEYRAT AKDLDGTGPG QGAFVLCRLF HKLEERNDTV KYEEVEQTGY  180
SPTMTKSSPD DTSSDLLQDT VSSDTQAQKP DNVMQNGQVT GDSSCNSHMT SDAEDHATEE  240
TAVEKYPLLE GNSNLYEPNF GEIDYKVFSP MNLHFFEDLP VCMDSPYASD FGHDQNGFYF  300
QDGTGEQDVS FSMLDEVLNN HEGSCAASNS QKNLVAGTEM PLSGNGFISK TIPPETSYIE  360
ESGIYSETDT EMAQLQSESE VGAPRWFGGH VDNKYSVQMQ TSFDTGDTQR ALYDQAFRIG  420
NNGSLGNCSV GQATSYTDSA MGNINNLQQL TSLKNNMNNG GNLGGGTGMN TRTFEPPQQP  480
NSDNFATLGI GTGIKIRTRA PQQRANSDNF VNQGTAPRRI RLQMKTSNGP MKVSAGCVDD  540
GKMRSTGLGE EEEVQSALTE ITEAEAAGQI PSSDESEKEN QLLKFDGSGD IAEESCTKLR  600
QRVKQDGEPC SSQIGPSVHS KVAPAHHRSR SLSIVVFTVF LITILLALFI GIWRCLRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-46816511171Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039299.20.0PREDICTED: protein NTM1-like 9
TrEMBLA0A061G2K50.0A0A061G2K5_THECC; NAC domain-containing protein 78, putative isoform 2
STRINGEOY238010.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55942848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.11e-139NAC 014
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]