PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG015584t1
Common NameTCM_015584
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 656aa    MW: 72527.6 Da    PI: 4.8977
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG015584t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.61.4e-5491361128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lp GfrF+Ptdeel+++yLk k++g++ e+ evi+e+d++k+ePwdLp  + +k+++ ew+fF++rd+ky++g+r+nrat++gyWkatgkd++
  Thecc1EG015584t1   9 LPLGFRFRPTDEELINHYLKLKINGRHSEV-EVIPEIDVCKWEPWDLPglSVIKSDDPEWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRT 100
                       699************************999.99***************6447888888*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++s k++l+g+kktLvfykgrapkg++t+W+mheyr+
  Thecc1EG015584t1 101 IKS-KKSLIGMKKTLVFYKGRAPKGQRTNWIMHEYRA 136
                       ***.899****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-624159IPR003441NAC domain
PROSITE profilePS5100557.8929159IPR003441NAC domain
PfamPF023653.2E-2810135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MAVLTMETLP LGFRFRPTDE ELINHYLKLK INGRHSEVEV IPEIDVCKWE PWDLPGLSVI  60
KSDDPEWFFF CPRDRKYPNG HRSNRATDKG YWKATGKDRT IKSKKSLIGM KKTLVFYKGR  120
APKGQRTNWI MHEYRATAKD LDGTGPGQGA FVLCRLFHKL EERNDTVKYE EVEQTGYSPT  180
MTKSSPDDTS SDLLQDTVSS DTQAQKPDNV MQNGQVTGDS SCNSHMTSDA EDHATEETAV  240
EKYPLLEGNS NLYEPNFGEI DYKVFSPMNL HFFEDLPVCM DSPYASDFGH DQNGFYFQDG  300
TGEQDVSFSM LDEVLNNHEG SCAASNSQKN LVAGTEMPLS GNGFISKTIP PETSYIEESG  360
IYSETDTEMA QLQSESEVGA PRWFGGHVDN KYSVQMQTSF DTGDTQRALY DQAFRIGNNG  420
SLGNCSVGQA TSYTDSAMGN INNLQQLTSL KNNMNNGGNL GGGTGMNTRT FEPPQQPNSD  480
NFATLGIGTG IKIRTRAPQQ RANSDNFVNQ GTAPRRIRLQ MKTSNGPMKV SAGCVDDGKM  540
RSTGLGEEEE VQSALTEITE AEAAGQIPSS DESEKENQLL KFDGSGDIAE ESCTKLRQRV  600
KQDGEPCSSQ IGPSVHSKVA PAHHRSRSLS IVVFTVFLIT ILLALFIGIW RCLRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-47916215171Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039299.20.0PREDICTED: protein NTM1-like 9
TrEMBLA0A061G1T30.0A0A061G1T3_THECC; NAC domain-containing protein 78, putative isoform 1
STRINGEOY238010.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.21e-143NAC 014
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]