PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG015535t1
Common NameTCM_015535
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 577aa    MW: 63633.5 Da    PI: 4.5253
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG015535t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.84.2e-5391371128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lp+GfrF+Ptdeel+++yL+ k++g+++++  vi+e+d++k+ePwdLp  +++++++ ew+fF++ d+ky++g+r nrat++gyWkatgkd++
  Thecc1EG015535t1   9 LPVGFRFRPTDEELIDFYLRSKINGNRTDEVGVIREIDVCKWEPWDLPdlSAIATRDPEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRK 101
                       79*************************99999***************96447778889*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++s +++l+g+kktLvfy+grap+g++t+Wvmheyr 
  Thecc1EG015535t1 102 IKS-GSSLIGMKKTLVFYTGRAPRGKRTNWVMHEYRT 137
                       ***.99*****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-603160IPR003441NAC domain
PROSITE profilePS5100557.6049160IPR003441NAC domain
PfamPF023651.1E-2710136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009814Biological Processdefense response, incompatible interaction
GO:0010200Biological Processresponse to chitin
GO:0070417Biological Processcellular response to cold
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
MAALSLNSLP VGFRFRPTDE ELIDFYLRSK INGNRTDEVG VIREIDVCKW EPWDLPDLSA  60
IATRDPEWFF FCPLDRKYPN GNRLNRATEA GYWKATGKDR KIKSGSSLIG MKKTLVFYTG  120
RAPRGKRTNW VMHEYRTTLD ELDGTKPGQN AFVICRLFKK DDETIEDING DEVDPALLTP  180
AEDMQSELVV PQDSPVVEGE AEKLPVSSET YPVGLPNEVI FNAVAPILEC NSIDYKAYGV  240
TGQVADIAPA EVDPIVEALS QFYDPMPDSL YCKLFSPLHS QIEAEQAPWM FNHVGNSFSG  300
VVIEHGTNEN DADISDFLND ILKNPDECCS DDSGSQKNST IESETPRAMA IGKDGSGSES  360
DAEVAQVLLG TETANRGGAP LEIKATAQDC TILNPKQDVN FSGTGPFFNV LNSNGELSNT  420
TCNVDNAITG IRIRSRTARS QPDTENSMTQ GNAPRRIRLQ CQFQVGPLYC GNAMNDWSSE  480
EKEDNSKPVF KEEVKVVEED ITVGGTMDEP QEISLSGSSK NSILRSKSIV SVCKEIQSRC  540
LKKFSARSSH KRFAVIFRVA VMSILFIILV SSLNVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-45816314171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00398DAPTransfer from AT3G49530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039233.20.0PREDICTED: NAC domain-containing protein 62
TrEMBLA0A061G9N70.0A0A061G9N7_THECC; NAC domain class transcription factor, putative isoform 1
STRINGEOY237340.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24162873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.11e-99NAC domain containing protein 62
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]