PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG015228t1
Common NameTCM_015228
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 629aa    MW: 67975.6 Da    PI: 5.8152
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG015228t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS357.71.7e-1092606282374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       +++++e+A a+s+g++  ++++L+rl + a+++g++ qRl  +++ AL++r+++       a +p + +e  s+e++aa++l++++sP++k++
  Thecc1EG015228t1 260 KQTIMEAASAISEGKTDVVNEILTRLAQVANSKGNSEQRLMECMLLALKSRVNS-------AENPPPVAELFSKEHAAATQLLYDLSPCFKLG 345
                       5789*************************************************9.......334444444569******************** PP

              GRAS  95 hltaNqaIleavege...ervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                       +l+aN aIl+a+  +   +++H+iDfdi+qG+Q+++Ll+aL++R +g+p +++iT++++++    e+l+ +g++L+++Ae++gv ++fnv+++
  Thecc1EG015228t1 346 FLAANLAILDATLDQpnsNKLHVIDFDIGQGGQYINLLHALSERGSGQPvMVKITAIADNA--GDERLKMVGDKLSQIAERFGVCLKFNVVAS 436
                       ***********98887889**************************888879********55..99*************************888 PP

              GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        +l+dl+ e+L ++p+E laVn++++l++++desvs+e++rde+L+ vk+l P+vv +veqe+++n+++F  r+ ea+ yy al ds+e++++
  Thecc1EG015228t1 437 LKLSDLSREALGCEPDEPLAVNFAFKLYQMPDESVSVENPRDELLRRVKGLAPRVVALVEQEMNTNTAPFTSRVGEACGYYGALIDSIESTVS 529
                       8******************************************************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk..sdgyrveeesgslvlgWkdrpL 367
                       r++ er+k+E+  l r+i n vaceg++r+er+e ++kWr+r+++aGF+  pls+++a+++++ l+  +  + g++v+ee+g + +gW++r+L
  Thecc1EG015228t1 530 RDKAERVKLEEG-LLRKIANSVACEGRDRVERCEVFGKWRARMSMAGFEFKPLSQSVAESMRARLSSGNrvNPGFTVKEENGGVSFGWMGRTL 621
                       ************.889**********************************************99988776789******************** PP

              GRAS 368 vsvSaWr 374
                       +++SaWr
  Thecc1EG015228t1 622 TVASAWR 628
                       ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.318233606IPR005202Transcription factor GRAS
PfamPF035145.8E-107260628IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MASGFSGGGP DFYGGIAGRS MANTGGMSNN QPTAPYRTQI PGIFMDPTSQ IVNRAAPNFI  60
GKRTLADFQT QQHQNNHPGL NSLYLRSVKP RTYQHTSPIS PLSPIDFSAN LSPDVSSNFS  120
SSSSCMSQRY GVPLLQQLRP QQLPLGTTSG TTIQVVNPGL SGVPYMNPAQ TRVVQQQDPE  180
KKMMNQLQEL EKQLLDDDND EEGDAVSVIT NTNSEWSETI QNLISSSSPN NPIAPSPTSS  240
TTSSSSSTSS VASPASTCSK QTIMEAASAI SEGKTDVVNE ILTRLAQVAN SKGNSEQRLM  300
ECMLLALKSR VNSAENPPPV AELFSKEHAA ATQLLYDLSP CFKLGFLAAN LAILDATLDQ  360
PNSNKLHVID FDIGQGGQYI NLLHALSERG SGQPVMVKIT AIADNAGDER LKMVGDKLSQ  420
IAERFGVCLK FNVVASLKLS DLSREALGCE PDEPLAVNFA FKLYQMPDES VSVENPRDEL  480
LRRVKGLAPR VVALVEQEMN TNTAPFTSRV GEACGYYGAL IDSIESTVSR DKAERVKLEE  540
GLLRKIANSV ACEGRDRVER CEVFGKWRAR MSMAGFEFKP LSQSVAESMR ARLSSGNRVN  600
PGFTVKEENG GVSFGWMGRT LTVASAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-3928962833375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007038779.10.0PREDICTED: scarecrow-like protein 8
SwissprotQ9FYR70.0SCL8_ARATH; Scarecrow-like protein 8
TrEMBLA0A061G0C70.0A0A061G0C7_THECC; Scarecrow-like protein 8, putative
STRINGEOY232800.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43502856
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.10.0SCARECROW-like 8
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]