PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG014713t1
Common NameTCM_014713
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 250aa    MW: 28680.6 Da    PI: 9.4692
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG014713t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM153.97.1e-48141371128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrF+Ptdeelv +yLk kv + +l++ ++i+e++++k++PwdLp    ++e+e yfFs+++ ky+ g+r nrat+sgyWkatg dk+++
  Thecc1EG014713t1  14 LPPGFRFQPTDEELVFQYLKCKVFSFPLPA-SIIPEINVCKYDPWDLP---GESEQERYFFSSKEAKYRIGNRINRATASGYWKATGLDKQIT 102
                       79****************************.89***************...3467899*********************************** PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s++ +  g++ktLvf+ g+ p+g++tdW+mheyrl
  Thecc1EG014713t1 103 SRRYQIAGMRKTLVFHMGKPPHGSRTDWIMHEYRL 137
                       *********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-5210174IPR003441NAC domain
PROSITE profilePS5100551.80714174IPR003441NAC domain
PfamPF023651.3E-2415137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MNKLNFVREG MTKLPPGFRF QPTDEELVFQ YLKCKVFSFP LPASIIPEIN VCKYDPWDLP  60
GESEQERYFF SSKEAKYRIG NRINRATASG YWKATGLDKQ ITSRRYQIAG MRKTLVFHMG  120
KPPHGSRTDW IMHEYRLVTV ASKDCNSPLS KNPIIQNYLN HHMEKWVVCR IFLKKRSEDE  180
TIQSFCNNNH EEKKSMAVPH EPKFFYFMRE KTGITPASSS SSSSSSSSIT EVSSSGADLE  240
ESSSHNIVR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-441417717168NO APICAL MERISTEM PROTEIN
1ut4_B2e-441417717168NO APICAL MERISTEM PROTEIN
1ut7_A2e-441417717168NO APICAL MERISTEM PROTEIN
1ut7_B2e-441417717168NO APICAL MERISTEM PROTEIN
4dul_A2e-441417717168NAC domain-containing protein 19
4dul_B2e-441417717168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007038082.10.0PREDICTED: NAC domain-containing protein 83
SwissprotQ9FY933e-74NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A061FZT40.0A0A061FZT4_THECC; NAC domain protein, IPR003441, putative
STRINGEOY225830.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2207445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.11e-74NAC domain containing protein 83
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]